Player Bowflexn's role (spell) or spec(restoration) isn't supported yet.
close

SimulationCraft 703-04

for World of Warcraft 7.0.3 Live (wow build level 22810, git build 1a5fc56)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
Instincts of the Mongoose (effect#1) base_value 20.00 10.00

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 movement,players_only=1,first=40,cooldown=85,distance=50,last=320

Actions per Minute / DPS Variance Summary

Mortwraith

Mortwraith : 268743 dps

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
268742.7 268742.7 5236.0 / 1.948% 18280.3 / 6.8% 19031.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.1 14.1 Fury 31.22% 42.3 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Chaos Blades (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 75

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 268743
Annihilation 34613 12.7% 32.7 8.42sec 413006 437001 Direct 65.3 142008 308716 206157 37.8% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.67 65.33 0.00 0.00 0.9451 0.0000 13491536.53 13491536.53 0.00 437001.15 437001.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.67 62.24% 142008.06 99716 184481 141639.77 138606 146968 5763342 5763342 0.00
crit 24.67 37.76% 308716.29 217381 402168 313231.16 304977 325301 7728195 7728195 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8758 3.3% 152.1 2.54sec 22861 10932 Direct 152.1 19926 39978 23142 35.6% 21.3%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.11 152.11 0.00 0.00 2.0913 0.0000 3477385.07 5112085.44 31.98 10931.56 10931.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.56 43.10% 19926.43 17762 21314 19921.43 19720 20264 1306486 1920659 31.98
crit 54.11 35.57% 39977.67 35524 42629 40134.39 39498 41133 2170899 3191427 31.98
miss 32.44 21.33% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4596 1.7% 152.1 2.54sec 11978 5728 Direct 152.1 9977 19987 11914 37.0% 17.2%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.11 152.11 0.00 0.00 2.0913 0.0000 1821976.11 2678477.46 31.98 5727.59 5727.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.78 45.87% 9976.60 8881 10657 10005.66 9921 10118 698240 1026479 31.98
crit 56.22 36.96% 19986.96 17762 21314 19969.12 19682 20209 1123736 1651999 31.98
miss 26.11 17.17% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chaos Blades (chaos_blade_mh) 10154 3.8% 21.0 16.55sec 191450 129558 Direct 21.0 137355 275910 187513 39.2% 0.0%  

Stats details: chaos_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.4777 0.0000 4020439.85 4020439.85 0.00 129557.87 129557.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.78 60.85% 137355.43 119498 143397 137898.76 134435 143397 1757947 1757947 0.00
crit 8.22 39.15% 275909.96 238996 286795 275587.63 266310 286795 2262493 2262493 0.00
 
 

Action details: chaos_blade_mh

Static Values
  • id:211796
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211796
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Blades (chaos_blade_oh) 4922 1.8% 21.0 16.55sec 93069 62982 Direct 21.0 68517 138400 96069 34.9% 0.0%  

Stats details: chaos_blade_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.4777 0.0000 1954454.25 1954454.25 0.00 62981.90 62981.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 65.08% 68516.83 59749 71699 68452.44 66388 70703 934739 934739 0.00
crit 7.33 34.92% 138400.27 119498 143397 139189.74 135431 143397 1019715 1019715 0.00
 
 

Action details: chaos_blade_oh

Static Values
  • id:211797
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211797
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Strike 68734 25.8% 96.8 3.71sec 282969 212243 Direct 193.4 98463 215210 142813 37.3% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.78 193.44 0.00 0.00 1.3332 0.0000 27385138.89 27385138.89 0.00 212243.48 212243.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.33 62.72% 98462.86 76705 142107 98313.07 97145 99838 11933978 11933978 0.00
crit 72.11 37.28% 215209.62 167216 309793 213832.24 209175 217047 15451161 15451161 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Demon Blades 18128 6.8% 215.2 4.74sec 33342 0 Direct 215.2 23833 47975 33254 39.2% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 215.22 215.22 0.00 0.00 0.0000 0.0000 7175862.29 7175862.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.89 60.82% 23833.37 20865 30924 23783.46 23549 24020 3114840 3114840 0.00
crit 84.33 39.18% 47974.53 41730 61849 48180.95 47143 49342 4061022 4061022 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 9812 (13813) 3.7% (5.2%) 8.1 47.97sec 676374 348172 Periodic 77.9 0 49671 49671 100.0% 0.0% 3.4%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 0.00 77.89 77.89 1.9427 0.1723 3899650.29 3899650.29 0.00 348171.74 348171.74
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 77.9 100.00% 49670.77 43899 65064 49978.96 47836 51251 3899650 3899650 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 4001 1.5% 0.0 0.00sec 0 0 Direct 8.1 147638 304041 208710 32.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.11 0.00 0.00 0.0000 0.0000 1586491.80 1586491.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 67.12% 147638.16 40098 200490 144161.16 111479 157545 795458 795458 0.00
crit 2.67 32.88% 304040.70 120294 400980 297384.69 247271 362817 791034 791034 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Rush 22361 8.3% 48.9 8.09sec 181185 448844 Direct 48.9 134806 268079 182225 35.2% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.89 48.89 0.00 0.00 0.4037 0.0000 8857935.60 8857935.60 0.00 448843.96 448843.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.67 64.77% 134806.47 129253 191568 134657.60 132561 136482 4261691 4261691 0.00
crit 17.22 35.23% 268079.01 258506 383136 267315.85 261091 278969 4596245 4596245 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 10520 (16732) 3.9% (6.3%) 7.2 60.28sec 919919 730576 Periodic 100.9 31129 61641 42066 35.6% 0.0% 5.4%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.22 0.00 50.44 100.89 1.2592 0.4284 4175331.99 4175331.99 0.00 216377.08 730576.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.0 64.43% 31128.94 16978 50327 30772.41 29063 31918 2004449 2004449 0.00
crit 35.9 35.57% 61641.44 33956 100654 61058.16 55721 68959 2170883 2170883 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 6212 2.3% 7.1 60.30sec 347137 0 Direct 7.1 353063 0 353063 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.0000 0.0000 2468526.33 2468526.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 100.00% 353063.18 244485 500756 347416.57 338529 364928 2468526 2468526 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:244484.88
  • base_dd_max:244484.88
 
Metamorphosis (_impact) 428 0.2% 2.0 0.00sec 83968 0 Direct 2.0 59553 118285 82143 38.9% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 167935.97 167935.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.22 61.11% 59553.38 54762 65714 46243.24 0 65714 73016 73016 0.00
crit 0.78 38.89% 118285.33 109523 131428 68147.93 0 131428 94920 94920 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 14304 5.3% 25.7 11.14sec 217502 0 Direct 25.7 160847 323995 213942 34.6% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.67 25.67 0.00 0.00 0.0000 0.0000 5582547.45 8206873.55 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.78 65.37% 160846.98 123216 182621 161206.00 154734 165112 2707131 3979738 31.98
crit 8.89 34.63% 323994.58 246432 365241 322947.44 299845 342067 2875417 4227135 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 20274 (50191) 7.5% (18.6%) 49.1 8.12sec 403048 323900 Direct 49.1 117088 231979 163045 39.6% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.11 49.11 0.00 0.00 1.2444 0.0000 7995545.60 11754209.40 31.98 323899.61 323899.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.67 60.41% 117088.30 94091 139454 116615.50 113206 118439 3463060 5091027 31.98
crit 19.44 39.59% 231978.96 188182 278908 233129.11 228473 241745 4532485 6663182 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 29917 11.1% 0.0 0.00sec 0 0 Periodic 190.9 61847 0 61847 0.0% 0.0% 96.3%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 190.89 190.89 0.0000 2.0000 11798607.67 11798607.67 0.00 30904.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.9 100.00% 61846.54 31050 139454 62156.09 55921 70896 11798608 11798608 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 1008 0.4% 16.0 25.46sec 24964 0 Direct 16.0 17258 34448 24035 44.4% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.00 16.00 0.00 0.00 0.0000 0.0000 399421.61 587187.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.89 55.56% 17258.40 16698 20623 17338.31 16698 17875 154093 226532 31.98
crit 7.11 44.44% 34448.41 33395 41246 34561.46 33395 35638 245328 360656 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Viciously assault nearby enemies and vault away. Assaulted enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 5.9 69.09sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Chaos Blades 3.7 123.85sec

Stats details: chaos_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chaos_blades

Static Values
  • id:211048
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
Spelldata
  • id:211048
  • name:Chaos Blades
  • school:physical
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 0.00sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1901 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 32.79% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 5.9 0.0 72.7sec 72.7sec 14.76% 48.09% 0.0(0.0) 5.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:14.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Chaos Blades 3.7 0.0 121.8sec 122.6sec 10.82% 14.86% 0.0(0.0) 3.6

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_chaos_blades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chaos_blades_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:211048
  • name:Chaos Blades
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
fel_rush_movement 2.4 0.0 141.1sec 141.1sec 0.16% 0.16% 0.0(0.0) 2.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Metamorphosis 10.1 0.0 40.8sec 41.6sec 19.47% 31.37% 0.0(0.0) 10.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:19.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 62.4 2.4 6.4sec 6.2sec 64.12% 63.16% 2.4(2.4) 61.9

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:64.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.1 16.1 25.0sec 12.1sec 1.35% 3.71% 16.1(16.1) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 244.8sec 0.0sec 12.30% 50.18% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rage of the Illidari 7.2 93.7 60.3sec 3.8sec 5.45% 33.66% 93.7(93.7) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 4.16% 37.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:4.16%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 16.0 0.0 25.3sec 25.3sec 4.03% 11.42% 0.0(0.0) 16.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:4.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 32.4 1295.4 40.0 39.7 10415.1
chaos_strike Fury 97.5 3901.5 40.0 40.3 7019.1
eye_beam Fury 8.1 403.8 50.0 49.8 13584.7
Resource Gains Type Count Total Average Overflow
demon_blades Fury 214.08 3408.54 (60.62%) 15.92 3.38 0.10%
fel_rush_dmg Fury 49.08 1225.00 (21.79%) 24.96 1.92 0.16%
annihilation Fury 12.46 249.23 (4.43%) 20.00 0.00 0.00%
chaos_strike Fury 37.00 740.00 (13.16%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 14.13 14.08
Combat End Resource Mean Min Max
Fury 9.50 8.00 11.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.1%

Procs

Count Interval
delayed_swing__out_of_range 4.9 176.5sec
delayed_swing__channeling 4.2 95.9sec
demon_blades_wasted 1.1 31.6sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Mortwraith Damage Per Second
Count 9
Mean 268742.75
Minimum 256548.12
Maximum 276972.40
Spread ( max - min ) 20424.28
Range [ ( max - min ) / 2 * 100% ] 3.80%
Standard Deviation 8014.4292
5th Percentile 256548.12
95th Percentile 274828.37
( 95th Percentile - 5th Percentile ) 18280.25
Mean Distribution
Standard Deviation 2671.4764
95.00% Confidence Intervall ( 263506.75 - 273978.75 )
Normalized 95.00% Confidence Intervall ( 98.05% - 101.95% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3416
0.1 Scale Factor Error with Delta=300 548313
0.05 Scale Factor Error with Delta=300 2193253
0.01 Scale Factor Error with Delta=300 54831340
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9
Mean 268742.75
Minimum 256548.12
Maximum 276972.40
Spread ( max - min ) 20424.28
Range [ ( max - min ) / 2 * 100% ] 3.80%
Standard Deviation 8014.4292
5th Percentile 256548.12
95th Percentile 274828.37
( 95th Percentile - 5th Percentile ) 18280.25
Mean Distribution
Standard Deviation 2671.4764
95.00% Confidence Intervall ( 263506.75 - 273978.75 )
Normalized 95.00% Confidence Intervall ( 98.05% - 101.95% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3416
0.1 Scale Factor Error with Delta=300 548313
0.05 Scale Factor Error with Delta=300 2193253
0.01 Scale Factor Error with Delta=300 54831340
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9
Mean 268742.75
Minimum 256548.12
Maximum 276972.40
Spread ( max - min ) 20424.28
Range [ ( max - min ) / 2 * 100% ] 3.80%
Damage
Sample Data Mortwraith Damage
Count 9
Mean 106258787.29
Minimum 91114835.09
Maximum 125079007.36
Spread ( max - min ) 33964172.28
Range [ ( max - min ) / 2 * 100% ] 15.98%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 9.23 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 5.92 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
0.00 consume_magic
A 16.00 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
B 45.54 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
0.00 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
C 1.15 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
D 7.15 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
0.00 death_sweep,if=variable.blade_dance
0.00 blade_dance,if=variable.blade_dance
0.00 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
E 32.38 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
F 48.00 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
G 8.08 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
H 97.54 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
0.00 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
I 0.08 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
J 2.54 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
K 3.77 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
L 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
M 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456K9CDFEAEEEFBEEEB7EFEBEEFEBEEFEEEAEF6GHBFJF6HHHBHFHHAHBFHDHHBFH7HBG6FAHHBHFBHHHBFHHHHHAFHHBHHFHGKDBFJ6HHAFHB7HFBHHBHHFBHHHAFHBG6HHHBFHHHHAFDFBHHHHBHF7BHHBFGJF6HAHHBFHHHBHFHHHAFDBLKMEEBEEFEEB7EEFBEFAEEEBEFEEBEFGBHFHHAHFBB6HFDHHHHHAFHFBHGBFB7HHBHHFAHHHBFBHHHBFHHHDAFKGBHFHBHHHHHBFHAFHB7HFBHH

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/110: 0% fury
Pre food Mortwraith 0.0/110: 0% fury
Pre augmentation Mortwraith 0.0/110: 0% fury
Pre potion Fluffy_Pillow 0.0/110: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 chaos_blades Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/110: 0% fury metamorphosis, chaos_blades, potion_of_the_old_war
0:00.399 throw_glaive Fluffy_Pillow 25.0/110: 23% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:01.471 fury_of_the_illidari Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:02.295 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war
0:03.120 Waiting 0.800 sec 25.0/110: 23% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war
0:03.920 annihilation Fluffy_Pillow 91.0/110: 83% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war
0:04.746 vengeful_retreat Fluffy_Pillow 51.0/110: 46% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:04.746 annihilation Fluffy_Pillow 51.0/110: 46% fury bloodlust, metamorphosis, chaos_blades, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:05.572 Waiting 1.200 sec 11.0/110: 10% fury bloodlust, metamorphosis, chaos_blades, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:06.772 annihilation Fluffy_Pillow 78.0/110: 71% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:07.599 annihilation Fluffy_Pillow 58.0/110: 53% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:08.424 throw_glaive Fluffy_Pillow 18.0/110: 16% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:09.250 fel_rush Fluffy_Pillow 18.0/110: 16% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:09.675 annihilation Fluffy_Pillow 43.0/110: 39% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:10.502 Waiting 0.500 sec 3.0/110: 3% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:11.002 annihilation Fluffy_Pillow 67.0/110: 61% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:11.826 Waiting 0.600 sec 27.0/110: 25% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war
0:12.426 annihilation Fluffy_Pillow 65.0/110: 59% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:13.251 fel_rush Fluffy_Pillow 45.0/110: 41% fury bloodlust, metamorphosis, potion_of_the_old_war
0:13.657 blur Fluffy_Pillow 70.0/110: 64% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:13.657 annihilation Fluffy_Pillow 70.0/110: 64% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:14.483 throw_glaive Fluffy_Pillow 30.0/110: 27% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:15.306 Waiting 1.400 sec 30.0/110: 27% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:16.706 annihilation Fluffy_Pillow 103.0/110: 94% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:17.531 fel_rush Fluffy_Pillow 83.0/110: 75% fury bloodlust, metamorphosis, blur, potion_of_the_old_war
0:17.942 annihilation Fluffy_Pillow 108.0/110: 98% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:18.768 annihilation Fluffy_Pillow 68.0/110: 62% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:19.593 throw_glaive Fluffy_Pillow 28.0/110: 25% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:20.419 Waiting 0.600 sec 28.0/110: 25% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:21.019 annihilation Fluffy_Pillow 93.0/110: 85% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:21.845 fel_rush Fluffy_Pillow 73.0/110: 66% fury bloodlust, metamorphosis, blur, potion_of_the_old_war
0:22.301 annihilation Fluffy_Pillow 98.0/110: 89% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:23.127 annihilation Fluffy_Pillow 58.0/110: 53% fury bloodlust, metamorphosis, blur, momentum
0:23.955 throw_glaive Fluffy_Pillow 38.0/110: 35% fury bloodlust, metamorphosis, momentum
0:24.782 Waiting 0.500 sec 38.0/110: 35% fury bloodlust, metamorphosis, momentum
0:25.282 annihilation Fluffy_Pillow 73.0/110: 66% fury bloodlust, metamorphosis, momentum
0:26.107 Waiting 0.600 sec 33.0/110: 30% fury bloodlust, metamorphosis
0:26.707 annihilation Fluffy_Pillow 99.0/110: 90% fury bloodlust, metamorphosis
0:27.532 annihilation Fluffy_Pillow 59.0/110: 54% fury bloodlust, metamorphosis
0:28.357 Waiting 1.200 sec 19.0/110: 17% fury bloodlust, metamorphosis
0:29.557 vengeful_retreat Fluffy_Pillow 78.0/110: 71% fury bloodlust, metamorphosis
0:29.746 annihilation Fluffy_Pillow 78.0/110: 71% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:30.571 throw_glaive Fluffy_Pillow 38.0/110: 35% fury bloodlust, momentum, vengeful_retreat_movement
0:31.602 auto_attack Fluffy_Pillow 38.0/110: 35% fury bloodlust, momentum
0:31.602 Waiting 0.600 sec 38.0/110: 35% fury bloodlust, momentum
0:32.202 eye_beam Fluffy_Pillow 51.0/110: 46% fury bloodlust, momentum
0:33.723 Waiting 3.800 sec 1.0/110: 1% fury bloodlust, metamorphosis, momentum
0:37.523 chaos_strike Fluffy_Pillow 49.0/110: 45% fury bloodlust
0:38.554 fel_rush Fluffy_Pillow 29.0/110: 26% fury bloodlust
0:38.974 throw_glaive Fluffy_Pillow 54.0/110: 49% fury bloodlust, momentum
0:40.006 fel_rush Fluffy_Pillow 54.0/110: 49% fury bloodlust, raid_movement, momentum
0:40.385 Waiting 1.400 sec 79.0/110: 72% fury bloodlust, raid_movement, momentum
0:41.785 throw_glaive Fluffy_Pillow 79.0/110: 72% fury raid_movement, momentum
0:43.292 auto_attack Fluffy_Pillow 79.0/110: 72% fury momentum
0:43.292 chaos_strike Fluffy_Pillow 79.0/110: 72% fury momentum
0:44.631 chaos_strike Fluffy_Pillow 59.0/110: 54% fury
0:45.970 Waiting 2.000 sec 19.0/110: 17% fury
0:47.970 chaos_strike Fluffy_Pillow 53.0/110: 48% fury
0:49.308 fel_rush Fluffy_Pillow 33.0/110: 30% fury
0:49.725 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
0:51.065 throw_glaive Fluffy_Pillow 18.0/110: 16% fury momentum
0:52.402 Waiting 0.200 sec 18.0/110: 16% fury momentum
0:52.602 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum
0:53.944 chaos_strike Fluffy_Pillow 50.0/110: 45% fury
0:55.285 vengeful_retreat Fluffy_Pillow 30.0/110: 27% fury
0:55.285 Waiting 1.900 sec 30.0/110: 27% fury momentum, vengeful_retreat_movement
0:57.185 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum
0:58.523 Waiting 0.800 sec 17.0/110: 15% fury momentum
0:59.323 fel_rush Fluffy_Pillow 17.0/110: 15% fury
0:59.757 throw_glaive Fluffy_Pillow 42.0/110: 38% fury momentum
1:01.095 chaos_strike Fluffy_Pillow 42.0/110: 38% fury momentum
1:02.433 fury_of_the_illidari Fluffy_Pillow 2.0/110: 2% fury momentum
1:03.773 Waiting 0.400 sec 2.0/110: 2% fury rage_of_the_illidari
1:04.173 chaos_strike Fluffy_Pillow 64.0/110: 58% fury rage_of_the_illidari
1:05.510 chaos_strike Fluffy_Pillow 44.0/110: 40% fury
1:06.847 Waiting 1.500 sec 24.0/110: 22% fury
1:08.347 fel_rush Fluffy_Pillow 24.0/110: 22% fury
1:09.044 throw_glaive Fluffy_Pillow 49.0/110: 45% fury momentum
1:10.383 chaos_strike Fluffy_Pillow 49.0/110: 45% fury momentum
1:11.722 Waiting 1.700 sec 29.0/110: 26% fury momentum
1:13.422 blur Fluffy_Pillow 91.0/110: 83% fury
1:13.657 chaos_strike Fluffy_Pillow 91.0/110: 83% fury blur
1:14.995 fel_rush Fluffy_Pillow 51.0/110: 46% fury blur
1:15.431 eye_beam Fluffy_Pillow 76.0/110: 69% fury blur, momentum
1:17.418 auto_attack Fluffy_Pillow 26.0/110: 24% fury metamorphosis, blur, momentum
1:17.418 throw_glaive Fluffy_Pillow 26.0/110: 24% fury metamorphosis, blur, momentum
1:18.881 Waiting 1.200 sec 26.0/110: 24% fury blur, momentum
1:20.081 vengeful_retreat Fluffy_Pillow 26.0/110: 24% fury blur
1:20.285 chaos_strike Fluffy_Pillow 93.0/110: 85% fury blur, momentum, vengeful_retreat_movement
1:21.623 chaos_strike Fluffy_Pillow 73.0/110: 66% fury blur, momentum
1:22.961 Waiting 1.400 sec 33.0/110: 30% fury blur, momentum
1:24.361 fel_rush Fluffy_Pillow 33.0/110: 30% fury
1:24.807 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
1:26.144 Waiting 0.100 sec 18.0/110: 16% fury momentum
1:26.244 throw_glaive Fluffy_Pillow 18.0/110: 16% fury momentum
1:27.778 Waiting 0.600 sec 18.0/110: 16% fury momentum
1:28.378 fel_rush Fluffy_Pillow 18.0/110: 16% fury
1:28.835 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
1:30.174 Waiting 1.700 sec 3.0/110: 3% fury momentum
1:31.874 chaos_strike Fluffy_Pillow 61.0/110: 55% fury momentum
1:33.211 Waiting 0.900 sec 21.0/110: 19% fury
1:34.111 chaos_strike Fluffy_Pillow 92.0/110: 84% fury
1:35.450 fel_rush Fluffy_Pillow 52.0/110: 47% fury
1:35.854 throw_glaive Fluffy_Pillow 77.0/110: 70% fury momentum
1:37.193 chaos_strike Fluffy_Pillow 77.0/110: 70% fury momentum
1:38.533 Waiting 0.300 sec 37.0/110: 34% fury momentum
1:38.833 chaos_strike Fluffy_Pillow 100.0/110: 91% fury momentum
1:40.171 chaos_strike Fluffy_Pillow 60.0/110: 55% fury
1:41.510 Waiting 1.900 sec 20.0/110: 18% fury
1:43.410 chaos_strike Fluffy_Pillow 82.0/110: 75% fury
1:44.749 chaos_strike Fluffy_Pillow 42.0/110: 38% fury
1:46.087 vengeful_retreat Fluffy_Pillow 22.0/110: 20% fury
1:46.087 throw_glaive Fluffy_Pillow 22.0/110: 20% fury momentum, vengeful_retreat_movement
1:47.426 Waiting 0.600 sec 22.0/110: 20% fury momentum
1:48.026 chaos_strike Fluffy_Pillow 84.0/110: 76% fury momentum
1:49.363 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum
1:50.702 fel_rush Fluffy_Pillow 44.0/110: 40% fury
1:51.061 chaos_strike Fluffy_Pillow 69.0/110: 63% fury momentum
1:52.399 Waiting 0.300 sec 29.0/110: 26% fury momentum
1:52.699 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum
1:54.038 throw_glaive Fluffy_Pillow 50.0/110: 45% fury momentum
1:55.377 chaos_strike Fluffy_Pillow 50.0/110: 45% fury
1:56.716 Waiting 2.900 sec 10.0/110: 9% fury
1:59.616 eye_beam Fluffy_Pillow 56.0/110: 51% fury
2:01.581 chaos_blades Fluffy_Pillow 6.0/110: 5% fury metamorphosis
2:01.581 Waiting 0.700 sec 6.0/110: 5% fury metamorphosis, chaos_blades
2:02.281 fury_of_the_illidari Fluffy_Pillow 6.0/110: 5% fury chaos_blades
2:03.771 Waiting 1.300 sec 6.0/110: 5% fury chaos_blades, rage_of_the_illidari
2:05.071 fel_rush Fluffy_Pillow 23.0/110: 21% fury raid_movement, chaos_blades, rage_of_the_illidari
2:05.483 throw_glaive Fluffy_Pillow 48.0/110: 44% fury raid_movement, chaos_blades, momentum
2:06.821 fel_rush Fluffy_Pillow 48.0/110: 44% fury raid_movement, chaos_blades, momentum
2:07.281 Waiting 0.900 sec 73.0/110: 66% fury raid_movement, chaos_blades, momentum
2:08.181 auto_attack Fluffy_Pillow 73.0/110: 66% fury chaos_blades, momentum
2:08.181 chaos_strike Fluffy_Pillow 73.0/110: 66% fury chaos_blades, momentum
2:09.520 Waiting 1.000 sec 33.0/110: 30% fury chaos_blades, momentum
2:10.520 chaos_strike Fluffy_Pillow 60.0/110: 55% fury chaos_blades, momentum
2:11.858 vengeful_retreat Fluffy_Pillow 40.0/110: 36% fury chaos_blades
2:11.858 throw_glaive Fluffy_Pillow 40.0/110: 36% fury chaos_blades, momentum, vengeful_retreat_movement
2:13.195 chaos_strike Fluffy_Pillow 40.0/110: 36% fury chaos_blades, momentum
2:14.535 Waiting 1.400 sec 0.0/110: 0% fury momentum
2:15.935 fel_rush Fluffy_Pillow 27.0/110: 25% fury
2:16.306 blur Fluffy_Pillow 52.0/110: 47% fury momentum
2:16.306 chaos_strike Fluffy_Pillow 52.0/110: 47% fury blur, momentum
2:17.643 Waiting 2.000 sec 12.0/110: 11% fury blur, momentum
2:19.643 throw_glaive Fluffy_Pillow 12.0/110: 11% fury blur, momentum
2:21.160 fel_rush Fluffy_Pillow 43.0/110: 39% fury blur
2:21.566 chaos_strike Fluffy_Pillow 68.0/110: 62% fury blur, momentum
2:22.905 Waiting 1.500 sec 28.0/110: 25% fury blur, momentum
2:24.405 chaos_strike Fluffy_Pillow 63.0/110: 57% fury blur, momentum
2:25.744 fel_rush Fluffy_Pillow 43.0/110: 39% fury blur
2:26.137 chaos_strike Fluffy_Pillow 68.0/110: 62% fury blur, momentum
2:27.477 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum
2:28.816 throw_glaive Fluffy_Pillow 28.0/110: 25% fury momentum
2:30.154 Waiting 0.800 sec 28.0/110: 25% fury
2:30.954 fel_rush Fluffy_Pillow 28.0/110: 25% fury
2:31.597 chaos_strike Fluffy_Pillow 53.0/110: 48% fury momentum
2:32.935 Waiting 0.700 sec 13.0/110: 12% fury momentum
2:33.635 chaos_strike Fluffy_Pillow 74.0/110: 67% fury momentum
2:34.974 chaos_strike Fluffy_Pillow 54.0/110: 49% fury momentum
2:36.313 Waiting 0.300 sec 34.0/110: 31% fury
2:36.613 vengeful_retreat Fluffy_Pillow 34.0/110: 31% fury
2:36.858 Waiting 0.600 sec 34.0/110: 31% fury momentum, vengeful_retreat_movement
2:37.458 throw_glaive Fluffy_Pillow 34.0/110: 31% fury momentum, vengeful_retreat_movement
2:38.953 Waiting 1.700 sec 34.0/110: 31% fury momentum
2:40.653 chaos_strike Fluffy_Pillow 102.0/110: 93% fury momentum
2:41.991 fel_rush Fluffy_Pillow 62.0/110: 56% fury
2:42.480 eye_beam Fluffy_Pillow 87.0/110: 79% fury momentum
2:44.496 auto_attack Fluffy_Pillow 37.0/110: 34% fury momentum
2:44.496 Waiting 0.600 sec 37.0/110: 34% fury momentum
2:45.096 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum
2:46.434 chaos_strike Fluffy_Pillow 47.0/110: 43% fury
2:47.771 Waiting 1.900 sec 7.0/110: 6% fury
2:49.671 chaos_strike Fluffy_Pillow 60.0/110: 55% fury
2:51.009 fel_rush Fluffy_Pillow 40.0/110: 36% fury
2:51.535 throw_glaive Fluffy_Pillow 65.0/110: 59% fury momentum
2:52.874 chaos_strike Fluffy_Pillow 65.0/110: 59% fury momentum
2:54.212 Waiting 0.100 sec 25.0/110: 23% fury momentum
2:54.312 chaos_strike Fluffy_Pillow 62.0/110: 56% fury momentum
2:55.651 Waiting 3.300 sec 22.0/110: 20% fury
2:58.951 chaos_strike Fluffy_Pillow 68.0/110: 62% fury
3:00.289 chaos_strike Fluffy_Pillow 48.0/110: 44% fury
3:01.628 vengeful_retreat Fluffy_Pillow 28.0/110: 25% fury
3:01.858 throw_glaive Fluffy_Pillow 28.0/110: 25% fury momentum, vengeful_retreat_movement
3:03.197 fury_of_the_illidari Fluffy_Pillow 28.0/110: 25% fury momentum
3:04.536 throw_glaive Fluffy_Pillow 28.0/110: 25% fury momentum, rage_of_the_illidari
3:05.874 fel_rush Fluffy_Pillow 28.0/110: 25% fury rage_of_the_illidari
3:06.355 chaos_strike Fluffy_Pillow 53.0/110: 48% fury momentum
3:07.695 Waiting 0.500 sec 13.0/110: 12% fury momentum
3:08.195 chaos_strike Fluffy_Pillow 84.0/110: 76% fury momentum
3:09.533 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum
3:10.873 chaos_strike Fluffy_Pillow 44.0/110: 40% fury
3:12.211 fel_rush Fluffy_Pillow 4.0/110: 4% fury
3:12.594 Waiting 0.200 sec 29.0/110: 26% fury momentum
3:12.794 chaos_strike Fluffy_Pillow 65.0/110: 59% fury momentum
3:14.132 throw_glaive Fluffy_Pillow 25.0/110: 23% fury momentum
3:15.470 Waiting 0.600 sec 25.0/110: 23% fury momentum
3:16.070 blur Fluffy_Pillow 25.0/110: 23% fury momentum
3:16.306 fel_rush Fluffy_Pillow 25.0/110: 23% fury blur
3:16.738 chaos_strike Fluffy_Pillow 50.0/110: 45% fury blur, momentum
3:18.077 Waiting 1.700 sec 10.0/110: 9% fury blur, momentum
3:19.777 chaos_strike Fluffy_Pillow 41.0/110: 37% fury blur, momentum
3:21.116 Waiting 5.200 sec 1.0/110: 1% fury blur
3:26.316 fel_rush Fluffy_Pillow 33.0/110: 30% fury
3:26.716 throw_glaive Fluffy_Pillow 58.0/110: 53% fury momentum
3:28.055 eye_beam Fluffy_Pillow 58.0/110: 53% fury momentum
3:30.115 fel_rush Fluffy_Pillow 8.0/110: 7% fury raid_movement, momentum
3:30.555 Waiting 0.200 sec 33.0/110: 30% fury raid_movement, momentum
3:30.755 throw_glaive Fluffy_Pillow 33.0/110: 30% fury raid_movement, momentum
3:32.337 Waiting 0.800 sec 33.0/110: 30% fury raid_movement, momentum
3:33.137 auto_attack Fluffy_Pillow 33.0/110: 30% fury momentum
3:33.137 Waiting 0.600 sec 33.0/110: 30% fury momentum
3:33.737 chaos_strike Fluffy_Pillow 102.0/110: 93% fury momentum
3:35.076 vengeful_retreat Fluffy_Pillow 62.0/110: 56% fury
3:35.076 chaos_strike Fluffy_Pillow 62.0/110: 56% fury momentum, vengeful_retreat_movement
3:36.416 Waiting 1.900 sec 22.0/110: 20% fury momentum
3:38.316 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum
3:39.655 fel_rush Fluffy_Pillow 15.0/110: 14% fury
3:40.067 throw_glaive Fluffy_Pillow 40.0/110: 36% fury momentum
3:41.404 chaos_strike Fluffy_Pillow 40.0/110: 36% fury momentum
3:42.742 Waiting 0.200 sec 0.0/110: 0% fury momentum
3:42.942 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum
3:44.279 Waiting 1.000 sec 28.0/110: 25% fury
3:45.279 chaos_strike Fluffy_Pillow 61.0/110: 55% fury
3:46.616 fel_rush Fluffy_Pillow 21.0/110: 19% fury
3:47.099 chaos_strike Fluffy_Pillow 46.0/110: 42% fury momentum
3:48.437 Waiting 0.200 sec 26.0/110: 24% fury momentum
3:48.637 throw_glaive Fluffy_Pillow 26.0/110: 24% fury momentum
3:50.132 Waiting 2.100 sec 26.0/110: 24% fury momentum
3:52.232 chaos_strike Fluffy_Pillow 84.0/110: 76% fury
3:53.570 chaos_strike Fluffy_Pillow 44.0/110: 40% fury
3:54.910 Waiting 1.900 sec 24.0/110: 22% fury
3:56.810 chaos_strike Fluffy_Pillow 40.0/110: 36% fury
3:58.150 Waiting 1.700 sec 0.0/110: 0% fury
3:59.850 vengeful_retreat Fluffy_Pillow 28.0/110: 25% fury
4:00.076 throw_glaive Fluffy_Pillow 28.0/110: 25% fury momentum, vengeful_retreat_movement
4:01.415 Waiting 1.600 sec 28.0/110: 25% fury momentum
4:03.015 fury_of_the_illidari Fluffy_Pillow 28.0/110: 25% fury momentum
4:04.537 fel_rush Fluffy_Pillow 28.0/110: 25% fury rage_of_the_illidari
4:04.986 Waiting 1.100 sec 53.0/110: 48% fury momentum, rage_of_the_illidari
4:06.086 metamorphosis Fluffy_Pillow 107.0/110: 97% fury momentum, rage_of_the_illidari
4:07.277 chaos_blades Fluffy_Pillow 107.0/110: 97% fury metamorphosis, momentum
4:07.277 potion Fluffy_Pillow 107.0/110: 97% fury metamorphosis, chaos_blades, momentum
4:07.277 annihilation Fluffy_Pillow 107.0/110: 97% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:08.349 annihilation Fluffy_Pillow 87.0/110: 79% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:09.420 fel_rush Fluffy_Pillow 67.0/110: 61% fury metamorphosis, chaos_blades, potion_of_the_old_war
4:09.760 annihilation Fluffy_Pillow 92.0/110: 84% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:10.833 annihilation Fluffy_Pillow 52.0/110: 47% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:11.903 throw_glaive Fluffy_Pillow 12.0/110: 11% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:12.976 Waiting 1.000 sec 12.0/110: 11% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:13.976 annihilation Fluffy_Pillow 76.0/110: 69% fury metamorphosis, chaos_blades, potion_of_the_old_war
4:15.047 Waiting 0.700 sec 36.0/110: 33% fury metamorphosis, chaos_blades, potion_of_the_old_war
4:15.747 annihilation Fluffy_Pillow 89.0/110: 81% fury metamorphosis, chaos_blades, potion_of_the_old_war
4:16.819 fel_rush Fluffy_Pillow 69.0/110: 63% fury metamorphosis, chaos_blades, potion_of_the_old_war
4:17.145 blur Fluffy_Pillow 94.0/110: 85% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war
4:17.145 annihilation Fluffy_Pillow 94.0/110: 85% fury metamorphosis, blur, chaos_blades, momentum, potion_of_the_old_war
4:18.217 annihilation Fluffy_Pillow 54.0/110: 49% fury metamorphosis, blur, chaos_blades, momentum, potion_of_the_old_war
4:19.289 throw_glaive Fluffy_Pillow 34.0/110: 31% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:20.360 Waiting 0.500 sec 34.0/110: 31% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:20.860 fel_rush Fluffy_Pillow 34.0/110: 31% fury metamorphosis, blur, potion_of_the_old_war
4:21.220 annihilation Fluffy_Pillow 59.0/110: 54% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:22.290 Waiting 0.100 sec 39.0/110: 35% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:22.390 throw_glaive Fluffy_Pillow 39.0/110: 35% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:23.671 Waiting 1.200 sec 39.0/110: 35% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:24.871 vengeful_retreat Fluffy_Pillow 39.0/110: 35% fury metamorphosis, blur, potion_of_the_old_war
4:25.076 annihilation Fluffy_Pillow 68.0/110: 62% fury metamorphosis, blur, momentum, vengeful_retreat_movement, potion_of_the_old_war
4:26.147 Waiting 0.200 sec 48.0/110: 44% fury metamorphosis, blur, momentum, out_of_range, potion_of_the_old_war
4:26.347 annihilation Fluffy_Pillow 48.0/110: 44% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:27.417 Waiting 1.300 sec 8.0/110: 7% fury metamorphosis, momentum, potion_of_the_old_war
4:28.717 annihilation Fluffy_Pillow 72.0/110: 65% fury metamorphosis, momentum, potion_of_the_old_war
4:29.789 fel_rush Fluffy_Pillow 52.0/110: 47% fury metamorphosis, potion_of_the_old_war
4:30.175 annihilation Fluffy_Pillow 77.0/110: 70% fury metamorphosis, momentum, potion_of_the_old_war
4:31.248 throw_glaive Fluffy_Pillow 37.0/110: 34% fury metamorphosis, momentum, potion_of_the_old_war
4:32.320 Waiting 0.100 sec 37.0/110: 34% fury metamorphosis, momentum
4:32.420 annihilation Fluffy_Pillow 96.0/110: 87% fury metamorphosis, momentum
4:33.491 annihilation Fluffy_Pillow 56.0/110: 51% fury metamorphosis, momentum
4:34.562 fel_rush Fluffy_Pillow 16.0/110: 15% fury metamorphosis
4:35.034 annihilation Fluffy_Pillow 41.0/110: 37% fury metamorphosis, momentum
4:36.105 Waiting 0.500 sec 1.0/110: 1% fury momentum
4:36.605 throw_glaive Fluffy_Pillow 1.0/110: 1% fury momentum
4:38.173 Waiting 2.100 sec 1.0/110: 1% fury momentum
4:40.273 eye_beam Fluffy_Pillow 67.0/110: 61% fury
4:42.298 fel_rush Fluffy_Pillow 17.0/110: 15% fury
4:42.713 chaos_strike Fluffy_Pillow 42.0/110: 38% fury momentum
4:44.052 throw_glaive Fluffy_Pillow 22.0/110: 20% fury momentum
4:45.391 Waiting 1.800 sec 22.0/110: 20% fury momentum
4:47.191 chaos_strike Fluffy_Pillow 86.0/110: 78% fury
4:48.529 chaos_strike Fluffy_Pillow 46.0/110: 42% fury
4:49.868 vengeful_retreat Fluffy_Pillow 6.0/110: 5% fury
4:50.076 Waiting 1.800 sec 6.0/110: 5% fury momentum, vengeful_retreat_movement
4:51.876 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
4:53.215 throw_glaive Fluffy_Pillow 3.0/110: 3% fury momentum
4:54.553 Waiting 0.500 sec 3.0/110: 3% fury
4:55.053 fel_rush Fluffy_Pillow 3.0/110: 3% fury raid_movement
4:55.437 Waiting 5.200 sec 28.0/110: 25% fury raid_movement, momentum
5:00.637 fel_rush Fluffy_Pillow 28.0/110: 25% fury raid_movement
5:01.282 auto_attack Fluffy_Pillow 53.0/110: 48% fury momentum
5:01.282 chaos_strike Fluffy_Pillow 53.0/110: 48% fury momentum
5:02.623 throw_glaive Fluffy_Pillow 33.0/110: 30% fury momentum
5:03.962 fury_of_the_illidari Fluffy_Pillow 33.0/110: 30% fury momentum
5:05.301 Waiting 0.700 sec 33.0/110: 30% fury rage_of_the_illidari
5:06.001 chaos_strike Fluffy_Pillow 90.0/110: 82% fury rage_of_the_illidari
5:07.340 chaos_strike Fluffy_Pillow 70.0/110: 64% fury
5:08.679 Waiting 1.900 sec 30.0/110: 27% fury
5:10.579 chaos_strike Fluffy_Pillow 58.0/110: 53% fury
5:11.918 Waiting 1.000 sec 18.0/110: 16% fury
5:12.918 chaos_strike Fluffy_Pillow 84.0/110: 76% fury
5:14.257 chaos_strike Fluffy_Pillow 44.0/110: 40% fury
5:15.595 vengeful_retreat Fluffy_Pillow 4.0/110: 4% fury
5:15.595 throw_glaive Fluffy_Pillow 4.0/110: 4% fury momentum, vengeful_retreat_movement
5:16.932 Waiting 0.600 sec 4.0/110: 4% fury momentum
5:17.532 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum
5:18.871 Waiting 0.500 sec 26.0/110: 24% fury momentum
5:19.371 throw_glaive Fluffy_Pillow 26.0/110: 24% fury momentum
5:20.877 fel_rush Fluffy_Pillow 26.0/110: 24% fury
5:21.285 chaos_strike Fluffy_Pillow 51.0/110: 46% fury momentum
5:22.624 Waiting 1.800 sec 11.0/110: 10% fury momentum
5:24.424 eye_beam Fluffy_Pillow 56.0/110: 51% fury momentum
5:26.457 fel_rush Fluffy_Pillow 6.0/110: 5% fury
5:26.869 Waiting 1.400 sec 31.0/110: 28% fury momentum
5:28.269 throw_glaive Fluffy_Pillow 31.0/110: 28% fury momentum
5:29.772 Waiting 0.900 sec 31.0/110: 28% fury momentum
5:30.672 fel_rush Fluffy_Pillow 31.0/110: 28% fury
5:31.348 blur Fluffy_Pillow 56.0/110: 51% fury momentum
5:31.348 chaos_strike Fluffy_Pillow 56.0/110: 51% fury blur, momentum
5:32.687 Waiting 1.000 sec 36.0/110: 33% fury blur, momentum
5:33.687 chaos_strike Fluffy_Pillow 63.0/110: 57% fury blur, momentum
5:35.025 fel_rush Fluffy_Pillow 43.0/110: 39% fury blur
5:35.467 chaos_strike Fluffy_Pillow 68.0/110: 62% fury blur, momentum
5:36.803 chaos_strike Fluffy_Pillow 48.0/110: 44% fury blur, momentum
5:38.143 throw_glaive Fluffy_Pillow 8.0/110: 7% fury blur, momentum
5:39.482 Waiting 0.900 sec 8.0/110: 7% fury blur
5:40.382 vengeful_retreat Fluffy_Pillow 8.0/110: 7% fury blur
5:40.595 Waiting 0.100 sec 8.0/110: 7% fury blur, momentum, vengeful_retreat_movement
5:40.695 chaos_strike Fluffy_Pillow 40.0/110: 36% fury blur, momentum, vengeful_retreat_movement
5:42.032 Waiting 0.900 sec 0.0/110: 0% fury momentum
5:42.932 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum
5:44.271 chaos_strike Fluffy_Pillow 46.0/110: 42% fury momentum
5:45.609 fel_rush Fluffy_Pillow 6.0/110: 5% fury
5:45.960 Waiting 0.100 sec 31.0/110: 28% fury momentum
5:46.060 throw_glaive Fluffy_Pillow 31.0/110: 28% fury momentum
5:47.568 Waiting 2.100 sec 31.0/110: 28% fury momentum
5:49.668 fel_rush Fluffy_Pillow 31.0/110: 28% fury
5:50.032 chaos_strike Fluffy_Pillow 56.0/110: 51% fury momentum
5:51.371 Waiting 0.800 sec 36.0/110: 33% fury momentum
5:52.171 chaos_strike Fluffy_Pillow 68.0/110: 62% fury momentum
5:53.508 Waiting 1.000 sec 28.0/110: 25% fury momentum
5:54.508 chaos_strike Fluffy_Pillow 82.0/110: 75% fury
5:55.846 fel_rush Fluffy_Pillow 42.0/110: 38% fury
5:56.222 throw_glaive Fluffy_Pillow 67.0/110: 61% fury momentum
5:57.561 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum
5:58.899 Waiting 2.600 sec 27.0/110: 25% fury momentum
6:01.499 chaos_strike Fluffy_Pillow 91.0/110: 83% fury
6:02.839 chaos_strike Fluffy_Pillow 71.0/110: 65% fury
6:04.178 fury_of_the_illidari Fluffy_Pillow 31.0/110: 28% fury
6:05.517 vengeful_retreat Fluffy_Pillow 31.0/110: 28% fury rage_of_the_illidari
6:05.595 throw_glaive Fluffy_Pillow 31.0/110: 28% fury momentum, rage_of_the_illidari, vengeful_retreat_movement
6:06.934 Waiting 0.100 sec 31.0/110: 28% fury momentum, rage_of_the_illidari
6:07.034 chaos_blades Fluffy_Pillow 31.0/110: 28% fury momentum, rage_of_the_illidari
6:07.277 Waiting 1.100 sec 31.0/110: 28% fury chaos_blades, momentum
6:08.377 eye_beam Fluffy_Pillow 93.0/110: 85% fury chaos_blades, momentum
6:10.432 fel_rush Fluffy_Pillow 43.0/110: 39% fury chaos_blades
6:10.793 chaos_strike Fluffy_Pillow 68.0/110: 62% fury chaos_blades, momentum
6:12.133 Waiting 0.600 sec 28.0/110: 25% fury chaos_blades, momentum
6:12.733 throw_glaive Fluffy_Pillow 28.0/110: 25% fury chaos_blades, momentum
6:14.260 Waiting 1.100 sec 28.0/110: 25% fury chaos_blades, momentum
6:15.360 chaos_strike Fluffy_Pillow 92.0/110: 84% fury chaos_blades
6:16.699 fel_rush Fluffy_Pillow 52.0/110: 47% fury chaos_blades
6:17.107 chaos_strike Fluffy_Pillow 77.0/110: 70% fury chaos_blades, momentum
6:18.445 Waiting 1.500 sec 37.0/110: 34% fury chaos_blades, momentum
6:19.945 chaos_strike Fluffy_Pillow 96.0/110: 87% fury momentum
6:21.285 chaos_strike Fluffy_Pillow 76.0/110: 69% fury
6:22.623 chaos_strike Fluffy_Pillow 56.0/110: 51% fury
6:23.961 Waiting 0.600 sec 16.0/110: 15% fury
6:24.561 chaos_strike Fluffy_Pillow 53.0/110: 48% fury
6:25.901 fel_rush Fluffy_Pillow 13.0/110: 12% fury
6:26.273 throw_glaive Fluffy_Pillow 38.0/110: 35% fury momentum
6:27.613 Waiting 1.600 sec 38.0/110: 35% fury momentum
6:29.213 chaos_strike Fluffy_Pillow 52.0/110: 47% fury momentum
6:30.552 vengeful_retreat Fluffy_Pillow 12.0/110: 11% fury
6:30.595 throw_glaive Fluffy_Pillow 12.0/110: 11% fury momentum, vengeful_retreat_movement
6:32.053 Waiting 1.800 sec 12.0/110: 11% fury momentum
6:33.853 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
6:35.190 Waiting 0.200 sec 18.0/110: 16% fury
6:35.390 fel_rush Fluffy_Pillow 18.0/110: 16% fury
6:35.976 blur Fluffy_Pillow 43.0/110: 39% fury momentum
6:35.976 chaos_strike Fluffy_Pillow 43.0/110: 39% fury blur, momentum
6:37.316 Waiting 2.100 sec 3.0/110: 3% fury blur, momentum
6:39.416 throw_glaive Fluffy_Pillow 28.0/110: 25% fury blur, momentum
6:40.951 fel_rush Fluffy_Pillow 28.0/110: 25% fury blur
6:41.382 chaos_strike Fluffy_Pillow 53.0/110: 48% fury blur, momentum
6:42.721 Waiting 0.400 sec 13.0/110: 12% fury blur, momentum
6:43.121 chaos_strike Fluffy_Pillow 48.0/110: 44% fury blur, momentum

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25682 23976 13803 (5938)
Stamina 32174 32174 20497
Intellect 5328 5003 0
Spirit 2 2 0
Health 1930440 1930440 0
Fury 110 110 0
Crit 36.31% 35.24% 6733
Haste 12.40% 12.40% 4029
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25682 23976 0
Mastery 23.51% 23.51% 5430
Armor 2065 2065 2065
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 855.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: { +75 Crit }
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Vest of the Shattered Abyss
ilevel: 840, stats: { 318 Armor, +1772 Sta, +1182 Agi, +899 Haste, +359 Mastery }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Dragonspur Wristguards
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +509 Crit, +225 Haste }
Local Hands Gloves of the Shattered Abyss
ilevel: 840, stats: { 199 Armor, +1329 Sta, +886 Agi, +633 Mastery, +310 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +882 Haste }, gems: { +200 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=75
talents=http://us.battle.net/wow/en/tool/talent-calculator#ga!0122000
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=75crit
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=vest_of_the_shattered_abyss,id=139715,bonus_id=3385/3384
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=dragonspur_wristguards,id=138219,bonus_id=1807/1472
hands=gloves_of_the_shattered_abyss,id=139717,bonus_id=3386/3384
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=anshes_token_of_guile,id=139113,bonus_id=3397/1808/604/1497/3336,gems=200agi
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=855.31
# gear_agility=13803
# gear_stamina=20497
# gear_crit_rating=6733
# gear_haste_rating=4029
# gear_mastery_rating=5430
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2065
# set_bonus=tier19oh_2pc=1

Táunks

Táunks : 232102 dps

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
232102.4 232102.4 5823.9 / 2.509% 21880.9 / 9.4% 18051.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.8 12.8 Fury 33.26% 39.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • skinning: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 232102
Annihilation 25903 10.9% 28.3 9.43sec 353392 382488 Direct 56.7 118120 268616 172511 38.8% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.33 56.67 0.00 0.00 0.9239 0.0000 10012762.45 10012762.45 0.00 382487.68 382487.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.67 61.18% 118119.63 94489 141535 117799.40 115659 119930 4083988 4083988 0.00
crit 22.00 38.82% 268616.23 211655 317038 270311.79 263550 277581 5928774 5928774 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 9231 4.0% 171.2 2.30sec 21420 10589 Direct 171.2 18688 37337 21607 35.4% 20.6%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 171.22 171.22 0.00 0.00 2.0229 0.0000 3667543.28 5391636.02 31.98 10588.57 10588.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.22 43.93% 18688.28 16820 20184 18706.29 18455 18940 1406913 2068296 31.98
crit 60.67 35.43% 37337.07 33640 40368 37279.12 36902 37622 2260630 3323340 31.98
miss 35.33 20.64% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4671 2.0% 171.2 2.30sec 10837 5362 Direct 171.2 9365 18680 10838 35.5% 19.7%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 171.22 171.22 0.00 0.00 2.0211 0.0000 1855450.96 2727688.67 31.98 5361.63 5361.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.67 44.78% 9365.47 8410 10092 9348.80 9183 9429 716913 1053930 31.98
crit 60.78 35.50% 18679.68 16820 20184 18734.12 18569 18916 1138538 1673759 31.98
miss 33.78 19.73% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chaos Strike 58487 25.5% 88.9 4.24sec 263258 201418 Direct 177.6 90760 202280 132327 36.8% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.89 177.56 0.00 0.00 1.3070 0.0000 23400751.19 23400751.19 0.00 201418.07 201418.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.22 63.20% 90759.68 72684 109026 90746.85 89062 92153 10177740 10177740 0.00
crit 65.33 36.80% 202280.15 162812 244217 202230.27 198704 206754 13223011 13223011 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Demon Blades 17809 7.7% 202.3 4.37sec 34751 0 Direct 202.3 25249 50979 34765 36.8% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 202.33 202.33 0.00 0.00 0.0000 0.0000 7031358.68 7031358.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.89 63.21% 25248.95 23338 28005 25277.56 25123 25650 3230961 3230961 0.00
crit 74.44 36.79% 50979.26 46675 56010 51051.59 50070 52121 3800398 3800398 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 8945 (12715) 3.9% (5.5%) 8.0 49.01sec 632507 323740 Periodic 80.0 0 44565 44565 100.0% 0.0% 3.4%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 0.00 80.00 80.00 1.9539 0.1702 3560414.23 3560414.23 0.00 323739.90 323739.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 80.0 100.00% 44564.60 40935 49122 44508.21 42777 46802 3560414 3560414 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 3770 1.6% 0.0 0.00sec 0 0 Direct 8.0 136081 280307 186005 34.7% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.00 0.00 0.00 0.0000 0.0000 1499640.39 1499640.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.22 65.28% 136080.62 45410 151366 137770.70 126138 146320 720388 720388 0.00
crit 2.78 34.72% 280306.62 252276 302731 279372.26 252276 302731 779252 779252 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 12543 5.4% 8.6 51.15sec 578310 389067 Direct 42.8 82993 164529 114177 39.0% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.56 42.78 42.78 0.00 1.4864 0.2000 4947762.14 4947762.14 0.00 389066.77 389066.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.11 61.04% 82993.06 63069 94603 83468.41 77403 86863 2186041 2186041 0.00
crit 16.67 38.96% 164529.05 126138 189207 166458.99 156301 186296 2761721 2761721 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging attacks have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 16701 7.2% 40.7 9.81sec 163466 403326 Direct 40.7 121167 243058 165324 34.7% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.67 40.67 0.00 0.00 0.4053 0.0000 6647614.34 6647614.34 0.00 403325.71 403325.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.56 65.30% 121166.69 120525 144630 121006.17 120525 121489 3213996 3213996 0.00
crit 14.11 34.70% 243058.42 241050 289260 243532.44 241050 246406 3433619 3433619 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 9047 3.9% 7.2 60.27sec 496701 408157 Periodic 99.1 26975 53094 36231 35.4% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.22 0.00 49.56 99.11 1.2170 0.4271 3587288.14 3587288.14 0.00 119751.91 408156.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.0 64.57% 26975.22 16088 38611 26863.46 25805 27820 1719639 1719639 0.00
crit 35.1 35.43% 53094.26 32176 77223 53381.98 50409 58332 1867649 1867649 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 5929 2.6% 7.4 53.37sec 316333 0 Direct 7.4 232987 450943 308798 37.3% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.44 7.44 0.00 0.00 0.0000 0.0000 2354925.95 2354925.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.67 62.69% 232987.35 204974 245969 235720.34 215223 245969 1097751 1097751 0.00
crit 2.78 37.31% 450943.27 409948 491938 447299.28 409948 491938 1257175 1257175 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Metamorphosis (_impact) 352 0.1% 2.0 0.00sec 68107 0 Direct 2.0 55888 104431 72691 22.2% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 136214.44 136214.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.56 77.78% 55887.98 51080 61296 57323.58 51080 61296 88539 88539 0.00
crit 0.44 22.22% 104431.07 102161 122593 47675.05 0 122593 47675 47675 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 12644 5.3% 26.6 10.40sec 184602 0 Direct 26.6 135733 268763 182864 36.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.56 26.56 0.00 0.00 0.0000 0.0000 4902211.16 7206714.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.78 63.18% 135732.92 118347 142017 136089.91 132812 139525 2282789 3355917 31.98
crit 9.78 36.82% 268763.06 236695 284034 267299.22 250220 279300 2619422 3850798 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 18277 (45166) 7.9% (19.5%) 49.9 7.93sec 358754 294392 Direct 49.9 106849 213460 146664 36.1% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.89 49.89 0.00 0.00 1.2186 0.0000 7242021.91 10646458.20 31.98 294392.04 294392.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.89 63.92% 106849.22 89187 107025 106767.95 105704 107025 3404979 5005642 31.98
crit 18.00 36.08% 213460.24 178375 214050 213180.18 209293 214050 3837043 5640816 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 26889 11.6% 0.0 0.00sec 0 0 Periodic 185.0 58126 0 58126 0.0% 0.0% 93.3%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 185.00 185.00 0.0000 2.0000 10655836.67 10655836.67 0.00 28799.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.0 100.00% 58125.63 32107 127078 57716.75 53405 60423 10655837 10655837 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 905 0.4% 16.2 25.24sec 22115 0 Direct 16.2 15827 31655 22008 39.7% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 0.0000 0.0000 358754.65 527403.32 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.78 60.27% 15827.41 15827 15827 15827.41 15827 15827 154757 227507 31.98
crit 6.44 39.73% 31654.82 31655 31655 31654.82 31655 31655 203998 299896 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Viciously assault nearby enemies and vault away. Assaulted enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 0.00sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1917 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.2 10.6 28.3sec 16.4sec 46.69% 67.10% 10.6(10.6) 13.6

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:46.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 24.38% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
fel_rush_movement 1.2 0.0 169.2sec 169.2sec 0.08% 0.08% 0.0(0.0) 1.2

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Metamorphosis 10.0 0.0 41.8sec 42.8sec 19.40% 31.89% 0.0(0.0) 10.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:19.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 55.7 1.2 7.2sec 7.1sec 56.41% 57.40% 1.2(1.2) 54.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:56.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.1 16.1 25.2sec 12.2sec 1.35% 2.29% 16.1(16.1) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 245.7sec 0.0sec 12.30% 50.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 4.83% 39.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:4.83%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 16.2 0.0 25.2sec 25.2sec 4.09% 9.58% 0.0(0.0) 16.1

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:4.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 28.3 1132.3 40.0 40.0 8842.8
chaos_strike Fury 89.3 3572.3 40.0 40.2 6550.6
eye_beam Fury 8.0 400.0 50.0 50.0 12650.1
Resource Gains Type Count Total Average Overflow
demon_blades Fury 203.00 3248.69 (63.28%) 16.00 4.31 0.13%
fel_rush_dmg Fury 40.77 1017.69 (19.82%) 24.96 1.54 0.15%
annihilation Fury 10.23 204.62 (3.99%) 20.00 0.00 0.00%
chaos_strike Fury 33.15 663.08 (12.92%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 12.91 12.83
Combat End Resource Mean Min Max
Fury 46.50 31.00 62.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.3%

Procs

Count Interval
delayed_swing__out_of_range 4.9 110.2sec
delayed_swing__channeling 12.9 59.3sec
fel_barrage 22.1 17.3sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Táunks Damage Per Second
Count 9
Mean 232102.40
Minimum 220289.48
Maximum 246122.45
Spread ( max - min ) 25832.98
Range [ ( max - min ) / 2 * 100% ] 5.56%
Standard Deviation 8914.2291
5th Percentile 220289.48
95th Percentile 242170.38
( 95th Percentile - 5th Percentile ) 21880.90
Mean Distribution
Standard Deviation 2971.4097
95.00% Confidence Intervall ( 226278.54 - 237926.26 )
Normalized 95.00% Confidence Intervall ( 97.49% - 102.51% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5666
0.1 Scale Factor Error with Delta=300 678345
0.05 Scale Factor Error with Delta=300 2713383
0.01 Scale Factor Error with Delta=300 67834597
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9
Mean 232102.40
Minimum 220289.48
Maximum 246122.45
Spread ( max - min ) 25832.98
Range [ ( max - min ) / 2 * 100% ] 5.56%
Standard Deviation 8914.2291
5th Percentile 220289.48
95th Percentile 242170.38
( 95th Percentile - 5th Percentile ) 21880.90
Mean Distribution
Standard Deviation 2971.4097
95.00% Confidence Intervall ( 226278.54 - 237926.26 )
Normalized 95.00% Confidence Intervall ( 97.49% - 102.51% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5666
0.1 Scale Factor Error with Delta=300 678345
0.05 Scale Factor Error with Delta=300 2713383
0.01 Scale Factor Error with Delta=300 67834597
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9
Mean 232102.40
Minimum 220289.48
Maximum 246122.45
Spread ( max - min ) 25832.98
Range [ ( max - min ) / 2 * 100% ] 5.56%
Damage
Sample Data Táunks Damage
Count 9
Mean 91860550.59
Minimum 77075221.90
Maximum 114987876.70
Spread ( max - min ) 37912654.79
Range [ ( max - min ) / 2 * 100% ] 20.64%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 13.62 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
0.00 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
7 0.00 call_action_list,name=cooldown
8 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
0.00 consume_magic
9 16.08 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
A 38.46 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
B 3.54 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
C 2.77 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
D 7.15 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
0.00 death_sweep,if=variable.blade_dance
0.00 blade_dance,if=variable.blade_dance
0.00 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
E 28.31 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
F 46.92 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
G 8.00 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
H 89.31 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
I 5.23 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
J 0.15 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
K 1.31 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
L 0.08 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
M 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
N 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124568B6CDF9EEEFAEEFAEEEEAEEFFEEE9FGEHHHACFK6HHAFH9HFHAHDHHHAFI6FG9HFAHHHAHFHHHH9FAFHAHIHHHDHAFF96GAIFHAHHHAFHF9HHHAHFHHAFI6HHG9FDAHFHAHHHHAFHF9HHAF6HAHFGH9F6HIAHHFAMNDEEEEAFEE9EEFAEEEFEEEAEFI6GH9FHHHAFHFAA6HDH9F6HHAFHHHAFHHG9FI6HAHFAHHHAFHH9F6HADFHHAHHFGHH9FHAHI6AFHHHAFH

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/110: 0% fury
Pre food Táunks 0.0/110: 0% fury
Pre augmentation Táunks 0.0/110: 0% fury
Pre potion Fluffy_Pillow 0.0/110: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/110: 0% fury metamorphosis, blood_frenzy, potion_of_the_old_war
0:00.452 fel_barrage Fluffy_Pillow 25.0/110: 23% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.773 auto_attack Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.773 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.553 fury_of_the_illidari Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.332 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:04.112 vengeful_retreat Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:04.112 Waiting 1.300 sec 25.0/110: 23% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:05.412 annihilation Fluffy_Pillow 49.0/110: 45% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:06.191 Waiting 0.200 sec 29.0/110: 26% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:06.391 annihilation Fluffy_Pillow 63.0/110: 57% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:07.168 annihilation Fluffy_Pillow 43.0/110: 39% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:07.948 throw_glaive Fluffy_Pillow 3.0/110: 3% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:08.728 fel_rush Fluffy_Pillow 3.0/110: 3% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:09.212 Waiting 1.200 sec 28.0/110: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:10.412 annihilation Fluffy_Pillow 58.0/110: 53% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:11.191 Waiting 0.500 sec 38.0/110: 35% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:11.691 annihilation Fluffy_Pillow 58.0/110: 53% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.471 throw_glaive Fluffy_Pillow 18.0/110: 16% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:13.249 fel_rush Fluffy_Pillow 18.0/110: 16% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:13.617 annihilation Fluffy_Pillow 43.0/110: 39% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:14.397 Waiting 1.400 sec 3.0/110: 3% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:15.797 annihilation Fluffy_Pillow 48.0/110: 44% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:16.575 Waiting 0.500 sec 28.0/110: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:17.075 annihilation Fluffy_Pillow 62.0/110: 56% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:17.854 annihilation Fluffy_Pillow 42.0/110: 38% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:18.634 Waiting 1.200 sec 2.0/110: 2% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.834 fel_rush Fluffy_Pillow 37.0/110: 34% fury bloodlust, metamorphosis, potion_of_the_old_war
0:20.394 annihilation Fluffy_Pillow 62.0/110: 56% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:21.233 annihilation Fluffy_Pillow 42.0/110: 38% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:22.072 throw_glaive Fluffy_Pillow 2.0/110: 2% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:22.911 throw_glaive Fluffy_Pillow 2.0/110: 2% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:23.750 Waiting 1.900 sec 2.0/110: 2% fury bloodlust, metamorphosis, momentum
0:25.650 annihilation Fluffy_Pillow 89.0/110: 81% fury bloodlust, metamorphosis
0:26.490 annihilation Fluffy_Pillow 49.0/110: 45% fury bloodlust, metamorphosis
0:27.329 Waiting 1.200 sec 29.0/110: 26% fury bloodlust, metamorphosis
0:28.529 annihilation Fluffy_Pillow 56.0/110: 51% fury bloodlust, metamorphosis
0:29.367 vengeful_retreat Fluffy_Pillow 36.0/110: 33% fury bloodlust, metamorphosis
0:29.367 throw_glaive Fluffy_Pillow 36.0/110: 33% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:30.205 Waiting 1.200 sec 36.0/110: 33% fury bloodlust, momentum, vengeful_retreat_movement
0:31.405 eye_beam Fluffy_Pillow 106.0/110: 96% fury bloodlust, momentum
0:33.009 annihilation Fluffy_Pillow 56.0/110: 51% fury bloodlust, metamorphosis, momentum
0:34.058 Waiting 1.000 sec 36.0/110: 33% fury bloodlust
0:35.058 chaos_strike Fluffy_Pillow 67.0/110: 61% fury bloodlust
0:36.105 chaos_strike Fluffy_Pillow 47.0/110: 43% fury bloodlust
0:37.151 Waiting 1.500 sec 7.0/110: 6% fury bloodlust
0:38.651 chaos_strike Fluffy_Pillow 40.0/110: 36% fury bloodlust
0:39.696 Waiting 0.400 sec 0.0/110: 0% fury bloodlust
0:40.096 fel_rush Fluffy_Pillow 0.0/110: 0% fury bloodlust, raid_movement
0:40.484 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, raid_movement, momentum
0:41.530 throw_glaive Fluffy_Pillow 25.0/110: 23% fury raid_movement, momentum
0:42.889 fel_rush Fluffy_Pillow 25.0/110: 23% fury raid_movement, momentum
0:43.295 auto_attack Fluffy_Pillow 50.0/110: 45% fury momentum
0:43.295 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum
0:44.655 Waiting 3.400 sec 10.0/110: 9% fury momentum
0:48.055 chaos_strike Fluffy_Pillow 67.0/110: 61% fury blood_frenzy
0:49.318 Waiting 0.600 sec 27.0/110: 25% fury blood_frenzy
0:49.918 fel_rush Fluffy_Pillow 27.0/110: 25% fury blood_frenzy
0:50.496 throw_glaive Fluffy_Pillow 52.0/110: 47% fury momentum, blood_frenzy
0:51.761 chaos_strike Fluffy_Pillow 52.0/110: 47% fury momentum, blood_frenzy
0:53.023 Waiting 1.100 sec 12.0/110: 11% fury momentum, blood_frenzy
0:54.123 vengeful_retreat Fluffy_Pillow 12.0/110: 11% fury blood_frenzy
0:54.367 Waiting 0.200 sec 12.0/110: 11% fury momentum, vengeful_retreat_movement, blood_frenzy
0:54.567 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, vengeful_retreat_movement, blood_frenzy
0:55.830 Waiting 0.400 sec 25.0/110: 23% fury momentum, blood_frenzy
0:56.230 throw_glaive Fluffy_Pillow 25.0/110: 23% fury momentum, blood_frenzy
0:57.735 Waiting 1.300 sec 25.0/110: 23% fury momentum, blood_frenzy
0:59.035 chaos_strike Fluffy_Pillow 72.0/110: 65% fury
1:00.395 fel_rush Fluffy_Pillow 32.0/110: 29% fury
1:00.778 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum
1:02.138 Waiting 0.200 sec 17.0/110: 15% fury momentum
1:02.338 fury_of_the_illidari Fluffy_Pillow 17.0/110: 15% fury momentum
1:03.913 Waiting 2.200 sec 17.0/110: 15% fury momentum
1:06.113 chaos_strike Fluffy_Pillow 56.0/110: 51% fury
1:07.472 Waiting 1.000 sec 16.0/110: 15% fury
1:08.472 chaos_strike Fluffy_Pillow 62.0/110: 56% fury
1:09.830 chaos_strike Fluffy_Pillow 42.0/110: 38% fury
1:11.189 fel_rush Fluffy_Pillow 2.0/110: 2% fury
1:11.624 throw_glaive Fluffy_Pillow 27.0/110: 25% fury momentum
1:12.981 fel_barrage Fluffy_Pillow 27.0/110: 25% fury momentum
1:14.500 auto_attack Fluffy_Pillow 27.0/110: 25% fury momentum, blood_frenzy
1:14.500 throw_glaive Fluffy_Pillow 27.0/110: 25% fury momentum, blood_frenzy
1:15.763 Waiting 1.500 sec 27.0/110: 25% fury blood_frenzy
1:17.263 eye_beam Fluffy_Pillow 59.0/110: 54% fury blood_frenzy
1:19.205 vengeful_retreat Fluffy_Pillow 9.0/110: 8% fury metamorphosis, blood_frenzy
1:19.367 Waiting 2.200 sec 25.0/110: 23% fury momentum, vengeful_retreat_movement, blood_frenzy
1:21.567 chaos_strike Fluffy_Pillow 60.0/110: 55% fury momentum, blood_frenzy
1:22.832 throw_glaive Fluffy_Pillow 20.0/110: 18% fury momentum, blood_frenzy
1:24.098 fel_rush Fluffy_Pillow 20.0/110: 18% fury blood_frenzy
1:24.516 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, blood_frenzy
1:25.780 Waiting 0.200 sec 25.0/110: 23% fury momentum, blood_frenzy
1:25.980 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, blood_frenzy
1:27.245 Waiting 0.900 sec 25.0/110: 23% fury momentum, blood_frenzy
1:28.145 chaos_strike Fluffy_Pillow 58.0/110: 53% fury blood_frenzy
1:29.409 Waiting 0.500 sec 18.0/110: 16% fury blood_frenzy
1:29.909 fel_rush Fluffy_Pillow 18.0/110: 16% fury blood_frenzy
1:30.434 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum, blood_frenzy
1:31.698 throw_glaive Fluffy_Pillow 3.0/110: 3% fury momentum, blood_frenzy
1:32.962 Waiting 4.100 sec 3.0/110: 3% fury momentum, blood_frenzy
1:37.062 chaos_strike Fluffy_Pillow 71.0/110: 65% fury
1:38.420 Waiting 1.000 sec 31.0/110: 28% fury
1:39.420 chaos_strike Fluffy_Pillow 66.0/110: 60% fury
1:40.780 Waiting 1.000 sec 26.0/110: 24% fury
1:41.780 chaos_strike Fluffy_Pillow 64.0/110: 58% fury
1:43.138 chaos_strike Fluffy_Pillow 44.0/110: 40% fury
1:44.499 vengeful_retreat Fluffy_Pillow 4.0/110: 4% fury
1:44.499 throw_glaive Fluffy_Pillow 4.0/110: 4% fury momentum, vengeful_retreat_movement
1:45.856 Waiting 2.700 sec 4.0/110: 4% fury momentum
1:48.556 fel_rush Fluffy_Pillow 39.0/110: 35% fury
1:48.924 throw_glaive Fluffy_Pillow 64.0/110: 58% fury momentum
1:50.308 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum
1:51.667 Waiting 0.900 sec 24.0/110: 22% fury momentum
1:52.567 fel_rush Fluffy_Pillow 24.0/110: 22% fury
1:52.992 chaos_strike Fluffy_Pillow 49.0/110: 45% fury momentum
1:54.351 fel_barrage Fluffy_Pillow 29.0/110: 26% fury momentum
1:56.003 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum, blood_frenzy
1:57.266 Waiting 0.800 sec 27.0/110: 25% fury blood_frenzy
1:58.066 chaos_strike Fluffy_Pillow 57.0/110: 52% fury blood_frenzy
1:59.330 Waiting 0.900 sec 37.0/110: 34% fury blood_frenzy
2:00.230 chaos_strike Fluffy_Pillow 51.0/110: 46% fury blood_frenzy
2:01.493 Waiting 0.900 sec 11.0/110: 10% fury blood_frenzy
2:02.393 fury_of_the_illidari Fluffy_Pillow 44.0/110: 40% fury blood_frenzy
2:03.817 chaos_strike Fluffy_Pillow 44.0/110: 40% fury blood_frenzy
2:05.081 fel_rush Fluffy_Pillow 4.0/110: 4% fury raid_movement, blood_frenzy
2:05.445 throw_glaive Fluffy_Pillow 29.0/110: 26% fury raid_movement, momentum, blood_frenzy
2:06.709 throw_glaive Fluffy_Pillow 29.0/110: 26% fury raid_movement, momentum
2:08.070 Waiting 1.200 sec 29.0/110: 26% fury raid_movement, momentum
2:09.270 vengeful_retreat Fluffy_Pillow 29.0/110: 26% fury raid_movement
2:09.499 auto_attack Fluffy_Pillow 29.0/110: 26% fury momentum, vengeful_retreat_movement
2:09.499 Waiting 2.400 sec 29.0/110: 26% fury momentum, vengeful_retreat_movement
2:11.899 eye_beam Fluffy_Pillow 64.0/110: 58% fury momentum
2:13.959 fel_rush Fluffy_Pillow 14.0/110: 13% fury
2:14.381 fel_barrage Fluffy_Pillow 39.0/110: 35% fury momentum
2:15.940 throw_glaive Fluffy_Pillow 39.0/110: 35% fury momentum
2:17.298 Waiting 1.600 sec 39.0/110: 35% fury momentum
2:18.898 chaos_strike Fluffy_Pillow 74.0/110: 67% fury
2:20.257 fel_rush Fluffy_Pillow 54.0/110: 49% fury
2:20.689 chaos_strike Fluffy_Pillow 79.0/110: 72% fury momentum
2:22.049 Waiting 1.600 sec 39.0/110: 35% fury momentum
2:23.649 chaos_strike Fluffy_Pillow 54.0/110: 49% fury momentum
2:25.010 Waiting 1.000 sec 34.0/110: 31% fury
2:26.010 chaos_strike Fluffy_Pillow 54.0/110: 49% fury
2:27.369 Waiting 2.500 sec 14.0/110: 13% fury
2:29.869 fel_rush Fluffy_Pillow 29.0/110: 26% fury
2:30.470 throw_glaive Fluffy_Pillow 54.0/110: 49% fury momentum
2:31.830 chaos_strike Fluffy_Pillow 54.0/110: 49% fury momentum
2:33.190 throw_glaive Fluffy_Pillow 14.0/110: 13% fury momentum
2:34.725 vengeful_retreat Fluffy_Pillow 14.0/110: 13% fury blood_frenzy
2:34.725 Waiting 0.500 sec 14.0/110: 13% fury momentum, vengeful_retreat_movement, blood_frenzy
2:35.225 chaos_strike Fluffy_Pillow 80.0/110: 73% fury momentum, vengeful_retreat_movement, blood_frenzy
2:36.489 chaos_strike Fluffy_Pillow 40.0/110: 36% fury momentum, blood_frenzy
2:37.752 Waiting 1.900 sec 0.0/110: 0% fury momentum, blood_frenzy
2:39.652 chaos_strike Fluffy_Pillow 65.0/110: 59% fury blood_frenzy
2:40.916 fel_rush Fluffy_Pillow 25.0/110: 23% fury blood_frenzy
2:41.264 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum, blood_frenzy
2:42.527 throw_glaive Fluffy_Pillow 10.0/110: 9% fury momentum, blood_frenzy
2:43.790 Waiting 2.400 sec 10.0/110: 9% fury momentum
2:46.190 chaos_strike Fluffy_Pillow 55.0/110: 50% fury blood_frenzy
2:47.452 Waiting 0.900 sec 35.0/110: 32% fury blood_frenzy
2:48.352 chaos_strike Fluffy_Pillow 47.0/110: 43% fury blood_frenzy
2:49.614 Waiting 0.300 sec 7.0/110: 6% fury blood_frenzy
2:49.914 fel_rush Fluffy_Pillow 7.0/110: 6% fury blood_frenzy
2:50.485 throw_glaive Fluffy_Pillow 32.0/110: 29% fury momentum, blood_frenzy
2:51.749 fel_barrage Fluffy_Pillow 32.0/110: 29% fury momentum, blood_frenzy
2:53.232 auto_attack Fluffy_Pillow 32.0/110: 29% fury momentum, blood_frenzy
2:53.232 Waiting 0.600 sec 32.0/110: 29% fury momentum, blood_frenzy
2:53.832 chaos_strike Fluffy_Pillow 51.0/110: 46% fury momentum, blood_frenzy
2:55.095 Waiting 0.900 sec 31.0/110: 28% fury blood_frenzy
2:55.995 chaos_strike Fluffy_Pillow 47.0/110: 43% fury blood_frenzy
2:57.257 Waiting 1.000 sec 27.0/110: 25% fury
2:58.257 eye_beam Fluffy_Pillow 65.0/110: 59% fury blood_frenzy
3:00.250 vengeful_retreat Fluffy_Pillow 15.0/110: 14% fury metamorphosis, blood_frenzy
3:00.250 throw_glaive Fluffy_Pillow 15.0/110: 14% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy
3:01.512 Waiting 0.800 sec 15.0/110: 14% fury momentum, blood_frenzy
3:02.312 fury_of_the_illidari Fluffy_Pillow 15.0/110: 14% fury momentum, blood_frenzy
3:03.816 Waiting 0.500 sec 15.0/110: 14% fury momentum, blood_frenzy
3:04.316 fel_rush Fluffy_Pillow 15.0/110: 14% fury blood_frenzy
3:04.685 chaos_strike Fluffy_Pillow 40.0/110: 36% fury momentum, blood_frenzy
3:05.949 Waiting 1.000 sec 0.0/110: 0% fury momentum, blood_frenzy
3:06.949 throw_glaive Fluffy_Pillow 0.0/110: 0% fury momentum, blood_frenzy
3:08.403 Waiting 0.900 sec 26.0/110: 24% fury
3:09.303 chaos_strike Fluffy_Pillow 76.0/110: 69% fury blood_frenzy
3:10.567 fel_rush Fluffy_Pillow 56.0/110: 51% fury blood_frenzy
3:10.986 chaos_strike Fluffy_Pillow 81.0/110: 74% fury momentum, blood_frenzy
3:12.251 chaos_strike Fluffy_Pillow 61.0/110: 55% fury momentum, blood_frenzy
3:13.517 chaos_strike Fluffy_Pillow 41.0/110: 37% fury momentum, blood_frenzy
3:14.781 Waiting 1.000 sec 1.0/110: 1% fury blood_frenzy
3:15.781 chaos_strike Fluffy_Pillow 56.0/110: 51% fury blood_frenzy
3:17.044 Waiting 2.900 sec 16.0/110: 15% fury blood_frenzy
3:19.944 fel_rush Fluffy_Pillow 32.0/110: 29% fury
3:20.479 throw_glaive Fluffy_Pillow 57.0/110: 52% fury momentum
3:21.838 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum
3:23.197 Waiting 0.600 sec 17.0/110: 15% fury momentum
3:23.797 throw_glaive Fluffy_Pillow 17.0/110: 15% fury momentum
3:25.358 vengeful_retreat Fluffy_Pillow 17.0/110: 15% fury
3:25.358 Waiting 2.000 sec 17.0/110: 15% fury momentum, vengeful_retreat_movement
3:27.358 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
3:28.717 Waiting 0.900 sec 3.0/110: 3% fury momentum
3:29.617 chaos_strike Fluffy_Pillow 74.0/110: 67% fury
3:30.975 fel_rush Fluffy_Pillow 34.0/110: 31% fury raid_movement
3:31.385 Waiting 1.400 sec 59.0/110: 54% fury raid_movement, momentum
3:32.785 throw_glaive Fluffy_Pillow 59.0/110: 54% fury raid_movement, momentum
3:34.394 Waiting 1.400 sec 59.0/110: 54% fury raid_movement, momentum
3:35.794 auto_attack Fluffy_Pillow 59.0/110: 54% fury
3:35.794 chaos_strike Fluffy_Pillow 59.0/110: 54% fury
3:37.153 Waiting 2.700 sec 39.0/110: 35% fury
3:39.853 fel_rush Fluffy_Pillow 39.0/110: 35% fury
3:40.513 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum
3:41.873 throw_glaive Fluffy_Pillow 24.0/110: 22% fury momentum
3:43.430 Waiting 4.200 sec 24.0/110: 22% fury momentum
3:47.630 eye_beam Fluffy_Pillow 84.0/110: 76% fury
3:49.600 Waiting 0.300 sec 34.0/110: 31% fury metamorphosis
3:49.900 chaos_strike Fluffy_Pillow 97.0/110: 88% fury blood_frenzy
3:51.164 vengeful_retreat Fluffy_Pillow 57.0/110: 52% fury blood_frenzy
3:51.164 throw_glaive Fluffy_Pillow 57.0/110: 52% fury momentum, vengeful_retreat_movement, blood_frenzy
3:52.427 auto_attack Fluffy_Pillow 57.0/110: 52% fury momentum, blood_frenzy
3:52.427 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum, blood_frenzy
3:53.690 fel_barrage Fluffy_Pillow 17.0/110: 15% fury momentum, blood_frenzy
3:55.239 fel_rush Fluffy_Pillow 47.0/110: 43% fury blood_frenzy
3:55.600 chaos_strike Fluffy_Pillow 72.0/110: 65% fury momentum, blood_frenzy
3:56.862 Waiting 0.500 sec 32.0/110: 29% fury momentum, blood_frenzy
3:57.362 chaos_strike Fluffy_Pillow 47.0/110: 43% fury momentum, blood_frenzy
3:58.625 Waiting 0.600 sec 7.0/110: 6% fury momentum, blood_frenzy
3:59.225 throw_glaive Fluffy_Pillow 7.0/110: 6% fury momentum, blood_frenzy
4:00.680 fel_rush Fluffy_Pillow 7.0/110: 6% fury
4:01.153 Waiting 0.700 sec 32.0/110: 29% fury momentum
4:01.853 metamorphosis Fluffy_Pillow 82.0/110: 75% fury momentum
4:03.082 potion Fluffy_Pillow 82.0/110: 75% fury metamorphosis, momentum
4:03.082 fury_of_the_illidari Fluffy_Pillow 82.0/110: 75% fury metamorphosis, momentum, potion_of_the_old_war
4:04.169 annihilation Fluffy_Pillow 82.0/110: 75% fury metamorphosis, momentum, potion_of_the_old_war
4:05.258 annihilation Fluffy_Pillow 42.0/110: 38% fury metamorphosis, potion_of_the_old_war
4:06.348 Waiting 1.600 sec 22.0/110: 20% fury metamorphosis, potion_of_the_old_war
4:07.948 annihilation Fluffy_Pillow 92.0/110: 84% fury metamorphosis, potion_of_the_old_war
4:09.037 annihilation Fluffy_Pillow 52.0/110: 47% fury metamorphosis, potion_of_the_old_war
4:10.126 fel_rush Fluffy_Pillow 12.0/110: 11% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:10.505 throw_glaive Fluffy_Pillow 37.0/110: 34% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:11.518 Waiting 0.100 sec 37.0/110: 34% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:11.618 annihilation Fluffy_Pillow 82.0/110: 75% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:12.630 annihilation Fluffy_Pillow 42.0/110: 38% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:13.643 Waiting 2.300 sec 2.0/110: 2% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:15.943 vengeful_retreat Fluffy_Pillow 31.0/110: 28% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:16.164 Waiting 0.600 sec 31.0/110: 28% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
4:16.764 annihilation Fluffy_Pillow 81.0/110: 74% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
4:17.776 annihilation Fluffy_Pillow 61.0/110: 55% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:18.789 throw_glaive Fluffy_Pillow 21.0/110: 19% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:19.803 Waiting 0.400 sec 21.0/110: 19% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:20.203 fel_rush Fluffy_Pillow 21.0/110: 19% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:20.619 annihilation Fluffy_Pillow 46.0/110: 42% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:21.631 Waiting 0.400 sec 6.0/110: 5% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:22.031 annihilation Fluffy_Pillow 69.0/110: 63% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:23.042 annihilation Fluffy_Pillow 49.0/110: 45% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:24.054 throw_glaive Fluffy_Pillow 29.0/110: 26% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:25.180 Waiting 0.400 sec 29.0/110: 26% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:25.580 annihilation Fluffy_Pillow 64.0/110: 58% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:26.593 Waiting 0.700 sec 24.0/110: 22% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:27.293 annihilation Fluffy_Pillow 44.0/110: 40% fury metamorphosis, potion_of_the_old_war
4:28.381 Waiting 0.800 sec 24.0/110: 22% fury metamorphosis
4:29.181 annihilation Fluffy_Pillow 57.0/110: 52% fury metamorphosis
4:30.270 fel_rush Fluffy_Pillow 17.0/110: 15% fury metamorphosis
4:30.663 annihilation Fluffy_Pillow 42.0/110: 38% fury metamorphosis, momentum
4:31.751 throw_glaive Fluffy_Pillow 22.0/110: 20% fury metamorphosis, momentum
4:32.840 fel_barrage Fluffy_Pillow 22.0/110: 20% fury momentum
4:34.380 auto_attack Fluffy_Pillow 22.0/110: 20% fury
4:34.380 Waiting 0.600 sec 22.0/110: 20% fury
4:34.980 eye_beam Fluffy_Pillow 57.0/110: 52% fury
4:37.006 Waiting 2.600 sec 7.0/110: 6% fury
4:39.606 chaos_strike Fluffy_Pillow 56.0/110: 51% fury
4:40.965 vengeful_retreat Fluffy_Pillow 16.0/110: 15% fury
4:41.164 throw_glaive Fluffy_Pillow 16.0/110: 15% fury momentum, vengeful_retreat_movement, blood_frenzy
4:42.426 Waiting 1.900 sec 16.0/110: 15% fury momentum, blood_frenzy
4:44.326 chaos_strike Fluffy_Pillow 69.0/110: 63% fury momentum, blood_frenzy
4:45.589 Waiting 0.900 sec 29.0/110: 26% fury blood_frenzy
4:46.489 chaos_strike Fluffy_Pillow 66.0/110: 60% fury blood_frenzy
4:47.754 Waiting 0.900 sec 26.0/110: 24% fury blood_frenzy
4:48.654 chaos_strike Fluffy_Pillow 55.0/110: 50% fury blood_frenzy
4:49.916 Waiting 0.200 sec 35.0/110: 32% fury blood_frenzy
4:50.116 fel_rush Fluffy_Pillow 35.0/110: 32% fury blood_frenzy
4:50.521 throw_glaive Fluffy_Pillow 60.0/110: 55% fury momentum, blood_frenzy
4:51.786 chaos_strike Fluffy_Pillow 60.0/110: 55% fury momentum, blood_frenzy
4:53.051 Waiting 0.800 sec 20.0/110: 18% fury momentum, blood_frenzy
4:53.851 throw_glaive Fluffy_Pillow 20.0/110: 18% fury momentum, blood_frenzy
4:55.295 fel_rush Fluffy_Pillow 20.0/110: 18% fury raid_movement
4:55.734 Waiting 4.200 sec 45.0/110: 41% fury raid_movement, momentum
4:59.934 fel_rush Fluffy_Pillow 45.0/110: 41% fury raid_movement
5:00.492 Waiting 0.300 sec 70.0/110: 64% fury raid_movement, momentum
5:00.792 auto_attack Fluffy_Pillow 70.0/110: 64% fury momentum
5:00.792 chaos_strike Fluffy_Pillow 70.0/110: 64% fury momentum
5:02.151 Waiting 0.700 sec 30.0/110: 27% fury momentum
5:02.851 fury_of_the_illidari Fluffy_Pillow 30.0/110: 27% fury momentum
5:04.443 Waiting 1.100 sec 30.0/110: 27% fury
5:05.543 chaos_strike Fluffy_Pillow 63.0/110: 57% fury
5:06.903 vengeful_retreat Fluffy_Pillow 23.0/110: 21% fury
5:06.903 throw_glaive Fluffy_Pillow 23.0/110: 21% fury momentum, vengeful_retreat_movement
5:08.261 auto_attack Fluffy_Pillow 23.0/110: 21% fury momentum
5:08.261 Waiting 0.600 sec 23.0/110: 21% fury momentum
5:08.861 chaos_strike Fluffy_Pillow 88.0/110: 80% fury momentum
5:10.220 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum
5:11.581 fel_rush Fluffy_Pillow 28.0/110: 25% fury blood_frenzy
5:11.985 throw_glaive Fluffy_Pillow 53.0/110: 48% fury momentum, blood_frenzy
5:13.249 chaos_strike Fluffy_Pillow 53.0/110: 48% fury momentum, blood_frenzy
5:14.513 Waiting 0.900 sec 13.0/110: 12% fury momentum, blood_frenzy
5:15.413 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum, blood_frenzy
5:16.677 Waiting 1.000 sec 27.0/110: 25% fury blood_frenzy
5:17.677 chaos_strike Fluffy_Pillow 46.0/110: 42% fury blood_frenzy
5:18.941 Waiting 1.000 sec 6.0/110: 5% fury blood_frenzy
5:19.941 fel_rush Fluffy_Pillow 21.0/110: 19% fury blood_frenzy
5:20.520 throw_glaive Fluffy_Pillow 46.0/110: 42% fury momentum
5:21.880 chaos_strike Fluffy_Pillow 46.0/110: 42% fury momentum
5:23.239 Waiting 1.300 sec 6.0/110: 5% fury momentum
5:24.539 chaos_strike Fluffy_Pillow 40.0/110: 36% fury
5:25.898 Waiting 3.300 sec 20.0/110: 18% fury
5:29.198 eye_beam Fluffy_Pillow 54.0/110: 49% fury blood_frenzy
5:31.152 Waiting 0.600 sec 4.0/110: 4% fury metamorphosis, blood_frenzy
5:31.752 vengeful_retreat Fluffy_Pillow 4.0/110: 4% fury blood_frenzy
5:31.903 throw_glaive Fluffy_Pillow 4.0/110: 4% fury momentum, vengeful_retreat_movement, blood_frenzy
5:33.167 fel_barrage Fluffy_Pillow 4.0/110: 4% fury momentum, blood_frenzy
5:34.717 auto_attack Fluffy_Pillow 4.0/110: 4% fury momentum, blood_frenzy
5:34.717 Waiting 0.600 sec 4.0/110: 4% fury momentum, blood_frenzy
5:35.317 chaos_strike Fluffy_Pillow 44.0/110: 40% fury momentum, blood_frenzy
5:36.580 fel_rush Fluffy_Pillow 4.0/110: 4% fury blood_frenzy
5:37.090 Waiting 0.400 sec 29.0/110: 26% fury momentum, blood_frenzy
5:37.490 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum, blood_frenzy
5:38.755 throw_glaive Fluffy_Pillow 26.0/110: 24% fury momentum, blood_frenzy
5:40.019 Waiting 0.600 sec 26.0/110: 24% fury momentum, blood_frenzy
5:40.619 fel_rush Fluffy_Pillow 26.0/110: 24% fury blood_frenzy
5:41.077 chaos_strike Fluffy_Pillow 51.0/110: 46% fury momentum, blood_frenzy
5:42.340 Waiting 4.000 sec 11.0/110: 10% fury momentum, blood_frenzy
5:46.340 chaos_strike Fluffy_Pillow 69.0/110: 63% fury
5:47.699 chaos_strike Fluffy_Pillow 49.0/110: 45% fury
5:49.058 Waiting 0.900 sec 9.0/110: 8% fury
5:49.958 fel_rush Fluffy_Pillow 9.0/110: 8% fury
5:50.541 throw_glaive Fluffy_Pillow 34.0/110: 31% fury momentum
5:51.900 Waiting 1.500 sec 34.0/110: 31% fury momentum
5:53.400 chaos_strike Fluffy_Pillow 95.0/110: 86% fury momentum
5:54.759 chaos_strike Fluffy_Pillow 55.0/110: 50% fury
5:56.119 Waiting 0.600 sec 15.0/110: 14% fury
5:56.719 vengeful_retreat Fluffy_Pillow 15.0/110: 14% fury
5:56.903 throw_glaive Fluffy_Pillow 15.0/110: 14% fury momentum, vengeful_retreat_movement
5:58.262 auto_attack Fluffy_Pillow 15.0/110: 14% fury momentum
5:58.262 Waiting 0.600 sec 15.0/110: 14% fury momentum
5:58.862 chaos_strike Fluffy_Pillow 49.0/110: 45% fury momentum
6:00.222 Waiting 0.700 sec 9.0/110: 8% fury momentum
6:00.922 fel_rush Fluffy_Pillow 9.0/110: 8% fury
6:01.306 Waiting 1.600 sec 34.0/110: 31% fury momentum
6:02.906 fury_of_the_illidari Fluffy_Pillow 34.0/110: 31% fury momentum
6:04.442 throw_glaive Fluffy_Pillow 34.0/110: 31% fury momentum
6:05.799 Waiting 0.100 sec 34.0/110: 31% fury
6:05.899 chaos_strike Fluffy_Pillow 103.0/110: 94% fury
6:07.259 chaos_strike Fluffy_Pillow 63.0/110: 57% fury
6:08.617 Waiting 1.300 sec 23.0/110: 21% fury blood_frenzy
6:09.917 fel_rush Fluffy_Pillow 23.0/110: 21% fury blood_frenzy
6:10.482 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum, blood_frenzy
6:11.747 Waiting 0.800 sec 28.0/110: 25% fury momentum, blood_frenzy
6:12.547 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum, blood_frenzy
6:13.812 throw_glaive Fluffy_Pillow 27.0/110: 25% fury momentum, blood_frenzy
6:15.074 Waiting 1.800 sec 27.0/110: 25% fury blood_frenzy
6:16.874 eye_beam Fluffy_Pillow 95.0/110: 86% fury blood_frenzy
6:18.923 chaos_strike Fluffy_Pillow 45.0/110: 41% fury
6:20.284 Waiting 1.300 sec 5.0/110: 5% fury
6:21.584 chaos_strike Fluffy_Pillow 70.0/110: 64% fury
6:22.944 vengeful_retreat Fluffy_Pillow 30.0/110: 27% fury
6:22.944 throw_glaive Fluffy_Pillow 30.0/110: 27% fury momentum, vengeful_retreat_movement
6:24.304 Waiting 1.900 sec 30.0/110: 27% fury momentum
6:26.204 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum
6:27.564 fel_rush Fluffy_Pillow 17.0/110: 15% fury
6:27.917 chaos_strike Fluffy_Pillow 42.0/110: 38% fury momentum
6:29.275 Waiting 1.200 sec 2.0/110: 2% fury momentum
6:30.475 fel_barrage Fluffy_Pillow 2.0/110: 2% fury momentum
6:32.093 auto_attack Fluffy_Pillow 2.0/110: 2% fury
6:32.093 fel_rush Fluffy_Pillow 2.0/110: 2% fury
6:32.520 throw_glaive Fluffy_Pillow 27.0/110: 25% fury momentum
6:33.878 Waiting 1.100 sec 27.0/110: 25% fury momentum
6:34.978 chaos_strike Fluffy_Pillow 98.0/110: 89% fury momentum
6:36.338 chaos_strike Fluffy_Pillow 58.0/110: 53% fury
6:37.695 Waiting 2.000 sec 38.0/110: 35% fury
6:39.695 chaos_strike Fluffy_Pillow 66.0/110: 60% fury blood_frenzy
6:40.958 fel_rush Fluffy_Pillow 26.0/110: 24% fury blood_frenzy
6:41.341 throw_glaive Fluffy_Pillow 51.0/110: 46% fury momentum, blood_frenzy
6:42.604 chaos_strike Fluffy_Pillow 51.0/110: 46% fury momentum, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 24941 23234 13097 (9303)
Stamina 31494 31494 19451
Intellect 5328 5003 0
Spirit 2 2 0
Health 1889640 1889640 0
Fury 110 110 0
Crit 37.78% 36.71% 7249
Haste 10.66% 10.66% 3464
Damage / Heal Versatility 2.40% 2.40% 961
Attack Power 24941 23234 0
Mastery 23.47% 23.47% 5415
Armor 2022 2022 2022
Run Speed 9 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 854.00
Local Head Biornskin Hood
ilevel: 835, stats: { 254 Armor, +1128 AgiInt, +1692 Sta, +723 Crit, +511 Mastery }
Local Neck Cursed Beartooth Necklace
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Haste }
Local Shoulders Dreadhide Mantle
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Haste }
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +574 Mastery, +406 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Grove Darkener's Treads
ilevel: 850, stats: { 226 Armor, +973 AgiInt, +1459 Sta, +658 Mastery, +322 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +454 Mastery, +294 Crit }
Local Hands Cruel Vice Grips
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +595 Crit, +421 Mastery }
Local Finger1 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 Leech }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }
Local Main Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }, relics: { +39 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=skinning=800
talents=http://us.battle.net/wow/en/tool/talent-calculator#ga!0122001
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:1:1001:3:1002:3:1003:3:1004:3:1006:3:1007:3:1010:1:1011:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=biornskin_hood,id=134196,bonus_id=3397/1497/3336
neck=cursed_beartooth_necklace,id=139239,bonus_id=1807/1472
shoulders=dreadhide_mantle,id=121298,bonus_id=3396/1492/3339
back=drape_of_the_manastarved,id=141543,bonus_id=1472
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1477/3336
hands=cruel_vice_grips,id=133617,bonus_id=1727/1512/3337
waist=lifeless_buckled_girdle,id=139197,bonus_id=1807/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=grove_darkeners_treads,id=134429,bonus_id=1727/1502/3336
finger1=ring_of_frozen_magic,id=141533,bonus_id=1482/3336
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/41/1472
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/136719/141255/0,relic_id=3432:1497:1674/1727:1492:1813/3432:1502:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=853.94
# gear_agility=13097
# gear_stamina=19451
# gear_crit_rating=7249
# gear_haste_rating=3464
# gear_mastery_rating=5415
# gear_versatility_rating=961
# gear_leech_rating=314
# gear_armor=2022

Buuey

Buuey : 259766 dps

  • Race: Tauren
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
259765.6 259765.6 3370.5 / 1.298% 9762.4 / 3.8% 41976.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.2 6.2 Astral Power 5.41% 43.3 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Buuey/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Blessing of the Ancients (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 752
  • jewelcrafting: 720

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Buuey 259766
Deadly Grace 8197 3.1% 25.0 10.14sec 127981 0 Direct 25.0 105050 214488 127591 20.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.00 25.00 0.00 0.00 0.0000 0.0000 3199514.39 3199514.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.89 79.56% 105049.61 88906 115578 105449.18 103576 107155 2097197 2097197 0.00
crit 5.11 20.44% 214487.98 181369 235779 217267.96 203133 235779 1102318 1102318 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 18195 7.0% 9.2 44.67sec 778758 311944 Direct 8.4 674988 1376976 871039 25.0%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.22 8.44 0.00 0.00 2.4965 0.0000 7181876.24 7181876.24 0.00 311943.54 311943.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 75.00% 674988.37 674988 674988 674988.37 674988 674988 4274926 4274926 0.00
crit 2.11 25.00% 1376976.27 1376976 1376976 1223978.91 0 1376976 2906950 2906950 0.00
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and all enemies near the target, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 10133 3.9% 9.6 43.04sec 419121 257735 Direct 9.6 337495 688489 410502 23.3%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.56 9.56 0.00 0.00 1.6262 0.0000 4004937.65 4004937.65 0.00 257734.58 257734.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.33 76.74% 337494.75 337495 337495 337494.75 337495 337495 2474961 2474961 0.00
crit 2.22 23.26% 688489.28 688489 688489 611990.47 0 688489 1529976 1529976 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 36489 14.1% 55.8 7.12sec 259308 156575 Direct 55.8 195609 400107 268000 31.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.78 55.78 0.00 0.00 1.6561 0.0000 14463624.46 14463624.46 0.00 156575.10 156575.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.33 68.73% 195608.58 187800 244140 195573.27 193434 196887 7499490 7499490 0.00
crit 17.44 31.27% 400106.62 383113 498046 399196.57 395883 403395 6964134 6964134 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 23798 9.1% 18.6 21.98sec 507242 400483 Direct 18.6 56193 111654 66692 18.0%  
Periodic 239.2 28038 57033 34224 21.0% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 239.22 239.22 1.2666 1.6541 9412160.12 9412160.12 0.00 22452.78 400483.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.22 82.04% 56193.07 45375 109876 57375.40 48694 66089 872342 872342 0.00
crit 3.33 17.96% 111653.65 92566 224147 115872.33 92566 172420 370622 370622 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.0 79.01% 28038.03 22688 54939 27993.96 26085 30308 5287635 5287635 0.00
crit 50.2 20.99% 57033.01 46284 112076 57288.55 49482 61973 2881561 2881561 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}. Usable while in Bear Form.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 5361 2.1% 9.0 45.26sec 235164 186885 Direct 10.0 168748 344246 210597 24.4%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 10.00 0.00 0.00 1.2584 0.0000 2116474.09 2116474.09 0.00 186885.13 186885.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.56 75.56% 168747.93 168748 168748 168747.93 168748 168748 1274984 1274984 0.00
crit 2.44 24.44% 344245.79 344246 344246 344245.79 344246 344246 841490 841490 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Solar Wrath 33185 12.9% 78.0 4.96sec 169679 158295 Direct 77.8 140782 281729 171163 20.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.00 77.78 0.00 0.00 1.0719 0.0000 13234923.63 13234923.63 0.00 158295.44 158295.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.67 79.29% 140782.25 91425 197722 140337.83 135480 147686 8652320 8652320 0.00
crit 16.11 20.71% 281728.70 186506 403353 286746.99 255768 325785 4582604 4582604 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starfall 9411 3.6% 11.7 27.97sec 317984 255251 Periodic 120.4 25166 51193 30782 21.8% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.67 0.00 0.00 120.44 1.2458 0.0000 3709814.39 3709814.39 0.00 255250.75 255250.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.2 78.23% 25166.16 24149 31394 25119.36 24149 26681 2368743 2368743 0.00
crit 26.2 21.77% 51193.47 49264 64043 51213.79 49264 53153 1341071 1341071 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.oneths_overconfidence.up
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}. Also applies Stellar Empowerment to each target, which increases damage taken from your Moonfire and Sunfire by {$197637s1=20}%.
 
Starsurge 52408 (61276) 20.2% (23.6%) 56.7 6.98sec 429549 346848 Direct 56.6 259667 532461 370778 39.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.67 56.56 0.00 0.00 1.2384 0.0000 20803575.26 20803575.26 0.00 346848.13 346848.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.00 60.12% 259666.78 246979 321073 258218.39 253422 266032 8784237 8784237 0.00
crit 22.56 39.88% 532461.49 503838 654990 533447.70 524450 543269 12019339 12019339 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively. You can accumulate up to {$164547u=3} of each Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 8868 3.4% 18.1 25.76sec 195324 0 Direct 18.0 156050 329333 200501 24.1%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.11 18.00 0.00 0.00 0.0000 0.0000 3537533.15 3537533.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 75.93% 156049.68 149997 194996 155628.48 149997 159997 2129960 2129960 0.00
crit 4.33 24.07% 329332.76 305994 397792 325422.42 305994 351893 1407573 1407573 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Stellar Flare 27460 10.6% 17.1 23.91sec 635374 509153 Direct 17.1 95429 175110 119836 31.2%  
Periodic 237.2 30223 61284 37012 21.8% 98.8%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.11 17.11 237.22 237.22 1.2479 1.6520 10871953.96 10871953.96 0.00 26308.80 509153.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.78 68.83% 95428.88 75000 181611 92712.76 75000 102337 1096370 1096370 0.00
crit 5.33 31.17% 175109.61 152999 284989 184377.31 152999 232193 977952 977952 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.4 78.17% 30223.48 10943 59025 30117.27 27189 32267 5587391 5587391 0.00
crit 51.8 21.83% 61283.90 15655 120412 62200.47 57404 66782 3210242 3210242 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<4&remains<7.2&astral_power>=15
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 22625 8.7% 14.0 29.66sec 638742 515026 Direct 14.0 55079 111244 70509 25.4%  
Periodic 239.1 27275 55641 33447 21.8% 99.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 14.00 239.11 239.11 1.2402 1.6511 8942391.71 8942391.71 0.00 21696.57 515025.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 74.60% 55079.13 44138 106879 54983.68 48369 61500 573496 573496 0.00
crit 3.56 25.40% 111243.52 90041 218033 100470.08 90041 128880 371931 371931 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.9 78.16% 27274.85 21759 53441 27277.67 24813 29869 5089217 5089217 0.00
crit 52.2 21.84% 55641.23 45022 109020 55643.16 50791 60388 2907748 2907748 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds} to the primary target and all enemies within $164815A2 yards.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Tormenting Cyclone 3636 1.4% 14.3 27.52sec 101714 0 Direct 99.3 12239 24998 14803 19.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.33 99.33 0.00 0.00 0.0000 0.0000 1457903.22 1457903.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.00 80.54% 12239.21 11847 15401 12183.26 11847 12455 977769 977769 0.00
crit 19.33 19.46% 24998.00 24168 31418 24802.18 24168 25328 480134 480134 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Simple Action Stats Execute Interval
Buuey
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Blessing of Elune 1.0 0.00sec

Stats details: blessing_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blessing_of_elune

Static Values
  • id:202737
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:202737
  • name:Blessing of Elune
  • school:arcane
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
 
Celestial Alignment 2.6 183.39sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 48.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.6 0.0 183.5sec 183.5sec 9.60% 45.92% 0.0(0.0) 2.6

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 41.6 15.1 9.3sec 6.9sec 80.41% 70.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • lunar_empowerment_1:58.42%
  • lunar_empowerment_2:17.98%
  • lunar_empowerment_3:4.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Intuition 1.8 0.0 113.8sec 113.8sec 1.03% 3.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_intuition
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_intuition_1:1.03%

Trigger Attempt Success

  • trigger_pct:13.78%

Spelldata details

  • id:209406
  • name:Oneth's Intuition
  • tooltip:Your next Starsurge costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Overconfidence 11.9 0.0 30.5sec 30.5sec 4.12% 50.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_overconfidence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_overconfidence_1:4.12%

Trigger Attempt Success

  • trigger_pct:21.19%

Spelldata details

  • id:209407
  • name:Oneth's Overconfidence
  • tooltip:Your next Starfall costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 191.1sec 0.0sec 12.30% 49.57% 0.0(0.0) 2.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 7.32% 38.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:7.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Solar Empowerment 50.8 5.9 7.6sec 6.9sec 49.80% 54.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • solar_empowerment_1:43.71%
  • solar_empowerment_2:5.28%
  • solar_empowerment_3:2.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Elune

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_blessing_of_elune
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_elune_1:100.00%

Spelldata details

  • id:202737
  • name:Blessing of Elune
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:15.00%

Resources

Resource Usage Type Count Total Average RPE APR
Buuey
starsurge Astral Power 57.0 2206.2 38.7 38.9 11033.3
stellar_flare Astral Power 17.1 256.2 15.0 15.0 42443.1
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 10.00 100.00 (4.03%) 10.00 0.00 0.00%
half_moon Astral Power 9.62 192.31 (7.74%) 20.00 0.00 0.00%
full_moon Astral Power 9.15 366.15 (14.74%) 40.00 0.00 0.00%
moonfire Astral Power 18.69 56.08 (2.26%) 3.00 0.00 0.00%
sunfire Astral Power 14.00 42.00 (1.69%) 3.00 0.00 0.00%
solar_wrath Astral Power 78.46 829.62 (33.41%) 10.57 0.00 0.00%
lunar_strike Astral Power 55.85 897.12 (36.13%) 16.06 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.24 6.18
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 10.75 4.00 17.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Buuey Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Buuey Damage Per Second
Count 9
Mean 259765.56
Minimum 254418.76
Maximum 271270.64
Spread ( max - min ) 16851.88
Range [ ( max - min ) / 2 * 100% ] 3.24%
Standard Deviation 5158.9646
5th Percentile 254418.76
95th Percentile 264181.18
( 95th Percentile - 5th Percentile ) 9762.43
Mean Distribution
Standard Deviation 1719.6549
95.00% Confidence Intervall ( 256395.10 - 263136.02 )
Normalized 95.00% Confidence Intervall ( 98.70% - 101.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1515
0.1 Scale Factor Error with Delta=300 227200
0.05 Scale Factor Error with Delta=300 908800
0.01 Scale Factor Error with Delta=300 22720022
Priority Target DPS
Sample Data Buuey Priority Target Damage Per Second
Count 9
Mean 259765.56
Minimum 254418.76
Maximum 271270.64
Spread ( max - min ) 16851.88
Range [ ( max - min ) / 2 * 100% ] 3.24%
Standard Deviation 5158.9646
5th Percentile 254418.76
95th Percentile 264181.18
( 95th Percentile - 5th Percentile ) 9762.43
Mean Distribution
Standard Deviation 1719.6549
95.00% Confidence Intervall ( 256395.10 - 263136.02 )
Normalized 95.00% Confidence Intervall ( 98.70% - 101.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1515
0.1 Scale Factor Error with Delta=300 227200
0.05 Scale Factor Error with Delta=300 908800
0.01 Scale Factor Error with Delta=300 22720022
DPS(e)
Sample Data Buuey Damage Per Second (Effective)
Count 9
Mean 259765.56
Minimum 254418.76
Maximum 271270.64
Spread ( max - min ) 16851.88
Range [ ( max - min ) / 2 * 100% ] 3.24%
Damage
Sample Data Buuey Damage
Count 9
Mean 102936682.26
Minimum 84765205.88
Maximum 125249734.44
Spread ( max - min ) 40484528.56
Range [ ( max - min ) / 2 * 100% ] 19.66%
DTPS
Sample Data Buuey Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Buuey Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Buuey Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Buuey Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Buuey Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Buuey Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BuueyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Buuey Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
B 0.23 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
C 17.08 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
D 18.69 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
E 14.00 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
F 2.69 celestial_alignment,if=astral_power>=40
G 11.77 starfall,if=buff.oneths_overconfidence.up
H 0.69 solar_wrath,if=buff.solar_empowerment.stack=3
I 3.23 lunar_strike,if=buff.lunar_empowerment.stack=3
J 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
K 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
L 10.15 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
M 9.38 solar_wrath,if=buff.solar_empowerment.up
N 8.23 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
O 0.69 solar_wrath
actions.single_target
# count action,conditions
P 9.15 new_moon,if=astral_power<=90
Q 9.69 half_moon,if=astral_power<=80
R 8.92 full_moon,if=astral_power<=60
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
S 46.85 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
T 47.15 solar_wrath,if=buff.solar_empowerment.up
U 45.69 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
V 21.92 solar_wrath

Sample Sequence

0123467DECQRFLMNLMNLMNLMNLDGPCTUVSTUVQESTUSTUVDCRSTUSETUPSGDTUCVVVSTQUSGTUVDSTURCESTUSTUVPSDGTUSTUCVVQSEDTUSGRCTUSTUEVPDSTUSTUVSTUCQVSGDTUVSTRSETUCUVF8LGDLMMLIMNLMPSGEDICQTURSSITTSGICDEPTUSTUUSTUQSGTDCUEVVSGRSGTTUSTDPCUUSTUEQUDSTUCVVSRESTTUSTDUPUSTCUVVSTUQSTDUVSETUCVRSGTSTUDUFLMNLGMNCEOLGPQDTSTUUST

Sample Sequence Table

time name target resources buffs
Pre flask Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre blessing_of_elune Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.216 sunfire Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.204 stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.192 half_moon Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:04.509 full_moon Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.481 celestial_alignment Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.481 starsurge Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:07.470 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:08.260 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:09.575 starsurge Fluffy_Pillow 58.5/100: 59% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:10.561 solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:11.351 lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:12.665 starsurge Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:13.652 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:14.442 lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:15.754 starsurge Fluffy_Pillow 53.5/100: 54% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:16.742 solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:17.533 lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:18.848 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:19.834 moonfire Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, oneths_overconfidence, potion_of_deadly_grace
0:20.820 starfall Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, oneths_overconfidence, potion_of_deadly_grace
0:21.806 new_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:22.795 stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:23.782 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:24.573 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:25.889 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust
0:26.876 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage bloodlust
0:27.864 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:28.654 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:29.967 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage bloodlust
0:30.956 half_moon Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage bloodlust
0:32.272 sunfire Fluffy_Pillow 59.0/100: 59% astral_power | 0.0/100: 0% rage bloodlust
0:33.258 starsurge Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage bloodlust
0:34.245 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:35.034 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:36.349 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage bloodlust
0:37.337 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:38.128 lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:39.442 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage bloodlust
0:40.429 Waiting 0.600 sec 32.0/100: 32% astral_power | 0.0/100: 0% rage bloodlust, raid_movement
0:41.029 moonfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement
0:42.311 Waiting 4.900 sec 35.0/100: 35% astral_power | 0.0/100: 0% rage raid_movement
0:47.211 stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
0:48.493 full_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
0:51.053 starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
0:52.334 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:53.359 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment
0:55.068 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
0:56.350 sunfire Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:57.635 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:58.662 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
1:00.370 new_moon Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
1:01.654 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
1:02.936 starfall Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
1:04.218 moonfire Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:05.500 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:06.526 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
1:08.234 stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
1:09.517 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
1:10.800 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
1:12.082 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:13.366 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
1:14.647 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:15.672 half_moon Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
1:17.381 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment
1:19.089 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
1:20.372 starfall Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
1:21.654 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:22.680 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment
1:24.390 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:25.673 moonfire Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
1:26.956 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
1:28.239 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:29.264 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
1:30.973 full_moon Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
1:33.533 stellar_flare Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage
1:34.818 sunfire Fluffy_Pillow 59.0/100: 59% astral_power | 0.0/100: 0% rage
1:36.100 starsurge Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage
1:37.383 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:38.409 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment
1:40.115 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
1:41.397 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:42.424 lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment
1:44.132 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
1:45.414 new_moon Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
1:46.698 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
1:47.980 moonfire Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
1:49.262 starfall Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
1:50.544 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:51.570 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
1:53.278 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
1:54.561 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:55.590 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
1:57.296 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
1:58.578 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
1:59.860 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
2:01.142 half_moon Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
2:02.850 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
2:04.133 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:05.415 Waiting 3.600 sec 13.0/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
2:09.015 moonfire Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
2:10.297 Waiting 1.900 sec 16.0/100: 16% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
2:12.197 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:13.224 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
2:14.933 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
2:16.216 starfall Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
2:17.499 full_moon Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:20.059 stellar_flare Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:21.343 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:22.369 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment
2:24.080 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
2:25.360 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:26.386 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment
2:28.093 sunfire Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
2:29.375 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
2:30.657 new_moon Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
2:31.938 moonfire Fluffy_Pillow 59.0/100: 59% astral_power | 0.0/100: 0% rage
2:33.221 starsurge Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage
2:34.502 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:35.531 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment
2:37.238 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
2:38.520 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:39.545 lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment
2:41.254 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:42.536 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:43.819 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:44.844 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment
2:46.553 stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
2:47.837 half_moon Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage
2:49.545 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:50.827 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:52.109 starfall Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
2:53.393 moonfire Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:54.676 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:55.703 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment
2:57.412 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
2:58.694 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
2:59.977 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:01.006 full_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
3:03.566 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage lunar_empowerment
3:04.849 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:06.132 solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:07.158 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:08.867 stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage lunar_empowerment
3:10.149 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
3:11.857 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
3:13.140 celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
3:13.140 potion Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage celestial_alignment
3:13.140 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:14.423 starfall Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, oneths_overconfidence, potion_of_deadly_grace
3:15.705 moonfire Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, oneths_intuition, potion_of_deadly_grace
3:16.988 starsurge Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, oneths_intuition, potion_of_deadly_grace
3:18.270 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), solar_empowerment(2), potion_of_deadly_grace
3:19.298 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), solar_empowerment, potion_of_deadly_grace
3:20.323 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), potion_of_deadly_grace
3:21.605 lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(3), solar_empowerment, potion_of_deadly_grace
3:23.314 solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), solar_empowerment, potion_of_deadly_grace
3:24.342 lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), potion_of_deadly_grace
3:26.051 starsurge Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:27.333 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment(2), solar_empowerment, potion_of_deadly_grace
3:28.360 new_moon Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage lunar_empowerment(2), potion_of_deadly_grace
3:29.642 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lunar_empowerment(2), potion_of_deadly_grace
3:30.924 starfall Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment(3), solar_empowerment, oneths_overconfidence, potion_of_deadly_grace
3:32.205 Waiting 1.500 sec 1.0/100: 1% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment(3), solar_empowerment, potion_of_deadly_grace
3:33.705 sunfire Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment(3), solar_empowerment, potion_of_deadly_grace
3:34.988 Waiting 2.100 sec 4.0/100: 4% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment(3), solar_empowerment, potion_of_deadly_grace
3:37.088 moonfire Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment(3), solar_empowerment, potion_of_deadly_grace
3:38.370 lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(3), solar_empowerment
3:40.078 stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:41.361 half_moon Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:43.071 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:44.100 lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:45.808 full_moon Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage lunar_empowerment
3:48.368 starsurge Fluffy_Pillow 92.0/100: 92% astral_power | 0.0/100: 0% rage lunar_empowerment
3:49.651 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:50.934 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment(3), solar_empowerment(2)
3:52.642 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2)
3:53.668 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:54.697 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:55.980 starfall Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(3), solar_empowerment, oneths_overconfidence
3:57.261 lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(3), solar_empowerment
3:58.968 stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:00.249 moonfire Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:01.532 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:02.813 new_moon Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:04.095 solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:05.121 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:06.829 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage lunar_empowerment
4:08.112 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:09.140 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:10.849 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
4:12.555 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
4:13.837 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:14.865 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
4:16.573 half_moon Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
4:18.281 starsurge Fluffy_Pillow 53.0/100: 53% astral_power | 0.0/100: 0% rage
4:19.565 starfall Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
4:20.847 solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:21.874 moonfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
4:23.155 stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
4:24.437 lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment
4:26.148 sunfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:27.431 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
4:28.714 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
4:29.997 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
4:31.280 starfall Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
4:32.561 full_moon Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:35.121 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:36.405 starfall Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2), oneths_overconfidence
4:37.687 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2)
4:38.715 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:39.739 lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:41.447 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage lunar_empowerment
4:42.728 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
4:43.756 moonfire Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:45.039 new_moon Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:46.320 stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:47.603 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
4:49.311 lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment
4:51.020 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
4:52.303 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:53.330 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment
4:55.005 sunfire Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:56.288 Waiting 5.900 sec 15.0/100: 15% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
5:02.188 half_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment
5:03.896 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage lunar_empowerment
5:05.605 moonfire Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
5:06.887 starsurge Fluffy_Pillow 53.0/100: 53% astral_power | 0.0/100: 0% rage
5:08.169 solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:09.195 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
5:10.903 stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
5:12.186 solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage
5:13.469 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
5:14.751 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
5:16.035 full_moon Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:18.595 sunfire Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:19.877 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:21.159 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2)
5:22.184 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:23.210 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
5:24.919 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lunar_empowerment
5:26.205 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:27.231 moonfire Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
5:28.514 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
5:30.223 new_moon Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment
5:31.505 lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage lunar_empowerment
5:33.214 starsurge Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
5:34.496 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:35.521 stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage lunar_empowerment
5:36.803 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment
5:38.512 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
5:39.793 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
5:41.077 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
5:42.361 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:43.388 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment
5:45.095 half_moon Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
5:46.805 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
5:48.088 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:49.115 moonfire Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
5:50.396 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment
5:52.103 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
5:53.386 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
5:54.669 sunfire Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:55.949 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:56.974 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
5:58.682 stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
5:59.964 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:01.247 full_moon Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:03.807 starsurge Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage
6:05.089 starfall Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
6:06.371 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:07.394 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage lunar_empowerment
6:08.677 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
6:09.706 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
6:11.415 moonfire Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
6:12.698 lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment
6:14.406 celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
6:14.406 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage celestial_alignment
6:15.689 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:16.714 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:18.422 starsurge Fluffy_Pillow 40.5/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment
6:19.706 starfall Fluffy_Pillow 0.5/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, oneths_overconfidence
6:20.987 solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:22.013 lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:23.721 stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage celestial_alignment
6:25.004 sunfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment
6:26.286 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage celestial_alignment
6:27.568 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment
6:28.849 starfall Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, oneths_overconfidence
6:30.132 new_moon Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:31.414 half_moon Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:33.121 moonfire Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:34.404 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:35.433 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage lunar_empowerment
6:36.716 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
6:37.742 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
6:39.450 lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment
6:41.156 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
6:42.437 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 33546 33546 20182
Intellect 33394 31688 22854 (10963)
Spirit 0 0 0
Health 2012760 2012760 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 33394 31688 0
Crit 21.92% 21.92% 5921
Haste 17.34% 16.19% 5261
Damage / Heal Versatility 2.08% 2.08% 834
Attack Power 9353 9028 0
Mastery 46.36% 46.36% 5312
Armor 7710 2056 2056
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 853.00
Local Head Purified Vision of Sargeras
ilevel: 840, stats: { 259 Armor, +1182 AgiInt, +1773 Sta, +763 Haste, +494 Crit }
Local Neck Tightweb Choker
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Shirt Gray Woolen Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 855, stats: { 335 Armor, +2038 Sta, +1359 AgiInt, +836 Mastery, +494 Haste }
Local Waist Dreadhide Girdle
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +542 Crit, +384 Haste }
Local Legs Felbat Leather Leggings
ilevel: 855, stats: { 293 Armor, +1359 AgiInt, +2039 Sta, +807 Crit, +523 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Oneth's Intuition
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 AgiInt, +496 Crit, +372 Haste }
Local Hands Seaweed "Leather" Mitts
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +704 Crit, +311 Vers, +435 Avoidance }
Local Finger1 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }
Local Finger2 Ring of Twisted Webbing
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Haste }
Local Trinket1 Nightmare Bloom
ilevel: 840, stats: { +1123 Int, +898 Haste }
Local Trinket2 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }, gems: { +150 Mastery }
Local Back Cloak of Unwavering Loyalty
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +481 Crit, +267 Mastery }
Local Main Hand Scythe of Elune
ilevel: 877, weapon: { 4315 - 6474, 3.6 }, stats: { +1668 Int, +2502 Sta, +734 Crit, +705 Mastery, +9100 Int }, relics: { +40 ilevels, +42 ilevels, +45 ilevels }
Local Tabard Orgrimmar Tabard
ilevel: 600

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Buuey"
origin="https://us.api.battle.net/wow/character/thrall/Buuey/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/220/133788636-avatar.jpg"
level=110
race=tauren
role=spell
position=back
professions=jewelcrafting=720/leatherworking=752
talents=http://us.battle.net/wow/en/tool/talent-calculator#Ua!2112222
artifact=59:0:0:0:0:1034:3:1035:3:1036:2:1038:3:1039:3:1040:3:1044:1:1045:1:1047:1:1048:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=purified_vision_of_sargeras,id=139946
neck=tightweb_choker,id=134541,bonus_id=1727/1492/1813
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1727/1507/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1477/3336
shirt=gray_woolen_shirt,id=2587
tabard=orgrimmar_tabard,id=118372
wrists=oneths_intuition,id=137092,bonus_id=1811
hands=seaweed_leather_mitts,id=141440,bonus_id=40/1472
waist=dreadhide_girdle,id=121299,bonus_id=3432/1497/1674
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1517/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=mindrend_band,id=138220,bonus_id=1807/1472
finger2=ring_of_twisted_webbing,id=134540,bonus_id=1727/1492/1813
trinket1=nightmare_bloom,id=121311,bonus_id=3432/604/1502/3336
trinket2=twisting_wind,id=139323,bonus_id=1807/1808/1472,gems=150mastery
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=137420/141275/139269/0,relic_id=1727:1492:1813/3397:1507:3337/1807:1477:3336/0

# Gear Summary
# gear_ilvl=853.47
# gear_stamina=20182
# gear_intellect=22854
# gear_crit_rating=5921
# gear_haste_rating=5261
# gear_mastery_rating=5312
# gear_versatility_rating=834
# gear_avoidance_rating=435
# gear_armor=2056

Oinkie

Oinkie : 315134 dps

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
315134.1 315134.1 6767.0 / 2.147% 28679.1 / 9.1% 20181.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.6 15.6 Energy 30.02% 45.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Incarnation: King of the Jungle (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 711

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 315134
Ashamane's Frenzy 15292 4.8% 5.7 79.25sec 1068760 1064004 Direct 85.0 9889 20126 13174 31.8%  
Periodic 28.3 124989 259166 177209 36.9% 18.6%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.67 85.00 113.33 28.33 1.0045 0.6500 6056308.21 6517818.92 7.08 76316.29 1064003.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.00 68.24% 9889.49 9051 11480 9887.15 9621 10187 572970 809573 29.23
crit 27.00 31.76% 20126.12 18464 23419 20111.01 19342 20583 544541 769449 29.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.9 63.14% 124988.68 99794 150627 125122.27 121368 131895 2234759 2234759 0.00
crit 10.4 36.86% 259165.82 203580 307279 258366.02 246396 278303 2704038 2704038 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 33365 10.6% 17.2 20.57sec 769496 0 Periodic 146.1 67736 136705 89618 33.0% 47.8%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.22 0.00 146.11 146.11 0.0000 1.2967 13252434.12 13252434.12 0.00 69947.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.9 67.00% 67735.52 2101 77748 67583.43 61771 71083 6631348 6631348 0.00
crit 48.2 33.00% 136705.13 2820 158606 137908.25 131497 146346 6621086 6621086 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 28374 9.0% 477.2 0.83sec 23601 28935 Direct 477.2 17434 35501 23588 34.2%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 477.22 477.22 0.00 0.00 0.8157 0.0000 11263090.50 15833368.61 28.86 28935.07 28935.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 314.22 65.84% 17434.25 15972 20258 17451.32 17363 17558 5484157 7709897 28.87
crit 163.00 34.16% 35501.24 32584 41327 35447.96 35196 35664 5778934 8123472 28.86
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 21773 6.9% 28.2 13.16sec 306499 305128 Direct 28.2 217403 494752 310096 31.9%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.22 28.22 0.00 0.00 1.0045 0.0000 8650079.36 12159058.68 28.86 305128.20 305128.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.22 68.11% 217403.07 111075 256618 217468.74 212258 220843 4180697 5880708 28.92
crit 9.00 31.89% 494751.97 415417 579546 495841.10 477578 510086 4469382 6278351 28.77
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 22099 7.0% 27.8 14.31sec 315909 314468 Direct 27.8 31151 63840 42529 34.0%  
Periodic 236.3 24028 49129 32281 32.5% 96.4%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.78 27.78 236.33 236.33 1.0046 1.6179 8775241.84 8775241.84 0.00 21389.46 314468.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.33 66.00% 31151.48 29784 35965 31069.89 30423 32172 570379 570379 0.00
crit 9.44 34.00% 63840.31 60760 73368 63653.29 60760 65925 602690 602690 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.4 67.47% 24028.07 1608 27973 23986.79 23812 24209 3826156 3826156 0.00
crit 76.9 32.53% 49129.26 7507 57064 49120.92 48340 49497 3776018 3776018 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11119 3.5% 25.4 13.30sec 172045 0 Direct 25.4 129832 268023 171746 31.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.44 25.44 0.00 0.00 0.0000 0.0000 4377597.27 6435482.64 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.56 69.00% 129832.27 122155 147503 129467.94 127020 133266 2273889 3342833 31.98
crit 7.89 31.00% 268022.56 249197 300905 266935.43 261657 274740 2103708 3092650 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 72547 23.1% 40.3 9.83sec 715711 712555 Direct 40.3 94714 197441 125123 29.2%  
Periodic 195.1 93110 185971 123503 32.6% 94.8%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.33 40.33 195.11 195.11 1.0044 1.9266 28867011.02 28867011.02 0.00 69321.86 712554.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.56 70.80% 94713.90 48937 177273 93912.66 87387 103482 2681526 2681526 0.00
crit 11.78 29.20% 197441.04 99831 361637 193131.32 158731 221216 2295388 2295388 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.4 67.37% 93109.83 97 177273 92061.37 87450 95547 12117477 12117477 0.00
crit 63.7 32.63% 185970.95 199 361637 184338.97 173241 194960 11772620 11772620 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 69758 22.1% 22.3 14.34sec 1239463 1233956 Periodic 293.7 70149 143238 94620 33.1% 98.7%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.33 0.00 293.67 293.67 1.0045 1.3325 27681333.04 27681333.04 0.00 66902.55 1233955.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 196.6 66.93% 70148.55 529 77748 70167.27 69623 70577 13794298 13794298 0.00
crit 97.1 33.07% 143237.55 1241 158606 142953.00 141710 144896 13887035 13887035 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 40807 13.0% 102.8 3.88sec 157761 157058 Direct 102.8 78017 200987 159573 65.5%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.78 102.78 0.00 0.00 1.0045 0.0000 16214318.06 22744822.95 28.71 157057.65 157057.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.44 34.49% 78016.93 58027 126167 77668.77 72332 80960 2756490 3878388 28.93
crit 67.33 65.51% 200986.67 118375 405375 199686.99 186459 210214 13457828 18866435 28.67
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Healing Touch 51.2 7.67sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.22 0.00 0.00 0.00 0.8268 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Incarnation: King of the Jungle (incarnation) 2.6 181.06sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.8138 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102543
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.tigers_fury.remains<gcd
Spelldata
  • id:102543
  • name:Incarnation: King of the Jungle
  • school:physical
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Tiger's Fury 12.9 30.70sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 4.0 85.03sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 5.9 2.1 60.1sec 42.9sec 16.80% 50.09% 2.1(2.1) 5.7

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5927.22

Stack Uptimes

  • acceleration_1:16.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Ashamane's Energy 12.9 0.0 30.7sec 30.7sec 9.72% 37.71% 38.7(38.7) 12.9

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:9.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 32.09% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.2 0.0 7.7sec 7.7sec 43.86% 56.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:15.77%
  • bloodtalons_2:28.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Clearcasting 35.0 1.8 10.5sec 10.0sec 9.45% 15.33% 1.8(1.8) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:9.45%

Trigger Attempt Success

  • trigger_pct:7.72%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Feral Instinct 2.6 0.0 181.4sec 181.4sec 9.60% 12.67% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • feral_instinct_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: King of the Jungle 2.6 0.0 181.4sec 181.4sec 19.20% 31.98% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_incarnation_king_of_the_jungle
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50

Stack Uptimes

  • incarnation_king_of_the_jungle_1:19.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102543
  • name:Incarnation: King of the Jungle
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 307.3sec 0.0sec 12.30% 49.97% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.6 0.0 7.7sec 7.7sec 69.51% 75.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:69.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 1.36% 26.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Tiger's Fury 12.9 0.0 30.7sec 30.7sec 25.59% 27.67% 0.0(0.0) 12.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:25.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 4.0 0.0 85.0sec 85.0sec 1.07% 70.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:1.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 58.5 981.3 16.8 34.8 8814.9
ferocious_bite Combo Points 29.2 146.2 5.0 5.2 59184.8
lunar_inspiration Energy 27.8 676.2 24.3 24.3 12978.2
rake Energy 40.5 1126.7 27.8 27.9 25620.1
rip Energy 22.2 425.8 19.2 19.1 65014.9
rip Combo Points 22.2 111.2 5.0 5.0 249036.2
shred Energy 104.2 2993.8 28.7 29.1 5415.9
Resource Gains Type Count Total Average Overflow
rake Combo Points 40.54 40.54 (15.50%) 1.00 0.00 0.00%
tigers_fury Energy 12.85 770.30 (10.61%) 59.96 0.47 0.06%
ashamanes_frenzy Combo Points 5.77 17.31 (6.62%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 27.85 27.85 (10.65%) 1.00 0.00 0.00%
shred Combo Points 104.15 104.15 (39.82%) 1.00 0.00 0.00%
energy_regen Energy 1876.92 4720.92 (65.04%) 2.52 161.38 3.31%
clearcasting Energy 36.54 1075.00 (14.81%) 29.42 0.00 0.00%
ashamanes_energy Energy 38.54 692.45 (9.54%) 17.97 78.32 10.16%
primal_fury Combo Points 90.77 71.69 (27.41%) 0.79 19.08 21.02%
Resource RPS-Gain RPS-Loss
Energy 15.58 15.64
Combo Points 0.65 0.64
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 26.75 5.83 47.68
Astral Power 0.00 0.00 0.00
Combo Points 5.00 5.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.7%

Procs

Count Interval
clearcasting 36.8 10.0sec
clearcasting_wasted 1.8 85.7sec
primal_fury 88.6 4.4sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Oinkie Damage Per Second
Count 9
Mean 315134.13
Minimum 296387.48
Maximum 329528.09
Spread ( max - min ) 33140.61
Range [ ( max - min ) / 2 * 100% ] 5.26%
Standard Deviation 10357.8725
5th Percentile 296387.48
95th Percentile 325066.57
( 95th Percentile - 5th Percentile ) 28679.09
Mean Distribution
Standard Deviation 3452.6242
95.00% Confidence Intervall ( 308367.11 - 321901.15 )
Normalized 95.00% Confidence Intervall ( 97.85% - 102.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4149
0.1 Scale Factor Error with Delta=300 915850
0.05 Scale Factor Error with Delta=300 3663403
0.01 Scale Factor Error with Delta=300 91585093
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9
Mean 315134.13
Minimum 296387.48
Maximum 329528.09
Spread ( max - min ) 33140.61
Range [ ( max - min ) / 2 * 100% ] 5.26%
Standard Deviation 10357.8725
5th Percentile 296387.48
95th Percentile 325066.57
( 95th Percentile - 5th Percentile ) 28679.09
Mean Distribution
Standard Deviation 3452.6242
95.00% Confidence Intervall ( 308367.11 - 321901.15 )
Normalized 95.00% Confidence Intervall ( 97.85% - 102.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4149
0.1 Scale Factor Error with Delta=300 915850
0.05 Scale Factor Error with Delta=300 3663403
0.01 Scale Factor Error with Delta=300 91585093
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9
Mean 315134.13
Minimum 296387.48
Maximum 329528.09
Spread ( max - min ) 33140.61
Range [ ( max - min ) / 2 * 100% ] 5.26%
Damage
Sample Data Oinkie Damage
Count 9
Mean 125137413.41
Minimum 102116848.59
Maximum 155383245.41
Spread ( max - min ) 53266396.82
Range [ ( max - min ) / 2 * 100% ] 21.28%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
8 4.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 5.00 auto_attack
0.00 skull_bash
0.00 berserk,if=buff.tigers_fury.up
B 1.15 incarnation,if=cooldown.tigers_fury.remains<gcd
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 12.85 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
E 1.54 incarnation,if=energy.time_to_max>1&energy>=35
F 0.38 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
G 51.00 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
H 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
I 0.00 call_action_list,name=finisher
J 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
0.00 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 22.23 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
0.00 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 28.85 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 5.77 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
N 39.54 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
O 27.85 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
P 104.15 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

01234579ABDMOKPPPGKNPPGLNOPGLPPPGKNPPGLOPPGLPDPPGKNP8OAGLNPPGKNOPDPGKNPOGLNPPGKMNOGLDNPPPGKNOPPGKNOPDG8ANKPOPGLNPPGKNOPGLNDPPPPGKNOGMLPPPGKNOPEPGDKNPOPGLNPPGLPPPGKNOPPGLPPP8GALPDNOPGKNPPGKNOPGLMPGKNODPPGKNPPPGLNOPPGKNPOPGDKNPPGLNOPP8GAKNOPGLDNPPGFPOGMLNPPOGLNPDPPGKNOPPGLNPOGECLNPPGDLNOPPGLPPPGLNPPGLONPPGLPGMLPPPGLDNPPOG

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 incarnation Fluffy_Pillow 76.9/100: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:01.759 tigers_fury Fluffy_Pillow 88.1/150: 59% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, feral_instinct, potion_of_the_old_war
0:01.759 ashamanes_frenzy Fluffy_Pillow 148.1/150: 99% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:02.762 lunar_inspiration Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.766 rip Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:04.772 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:05.776 shred Fluffy_Pillow 144.9/150: 97% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:06.781 shred Fluffy_Pillow 139.8/150: 93% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:07.785 healing_touch Fluffy_Pillow 134.8/150: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:08.538 rip Fluffy_Pillow 145.9/150: 97% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, tigers_fury, potion_of_the_old_war
0:09.544 rake Fluffy_Pillow 147.6/150: 98% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:10.549 shred Fluffy_Pillow 148.6/150: 99% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:11.555 shred Fluffy_Pillow 147.1/150: 98% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:12.559 healing_touch Fluffy_Pillow 145.6/150: 97% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:13.313 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, acceleration, potion_of_the_old_war
0:14.317 rake Fluffy_Pillow 143.5/150: 96% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:15.323 lunar_inspiration Fluffy_Pillow 144.5/150: 96% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:16.327 shred Fluffy_Pillow 148.0/150: 99% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
0:17.331 healing_touch Fluffy_Pillow 146.5/150: 98% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
0:18.085 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons(2), acceleration, potion_of_the_old_war
0:19.090 shred Fluffy_Pillow 143.5/150: 96% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, acceleration, potion_of_the_old_war
0:20.094 shred Fluffy_Pillow 142.0/150: 95% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
0:21.099 shred Fluffy_Pillow 140.5/150: 94% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
0:22.104 healing_touch Fluffy_Pillow 139.0/150: 93% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
0:22.858 rip Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, bloodtalons(2), acceleration, potion_of_the_old_war
0:23.862 rake Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, acceleration
0:24.868 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:25.872 shred Fluffy_Pillow 148.5/150: 99% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:26.875 healing_touch Fluffy_Pillow 147.0/150: 98% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:27.630 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons(2), acceleration
0:28.633 lunar_inspiration Fluffy_Pillow 143.5/150: 96% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, acceleration
0:29.637 shred Fluffy_Pillow 147.0/150: 98% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, acceleration
0:30.641 shred Fluffy_Pillow 145.4/150: 97% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:31.645 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:32.400 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:33.405 shred Fluffy_Pillow 64.9/100: 65% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness
0:34.410 tigers_fury Fluffy_Pillow 39.9/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:34.410 shred Fluffy_Pillow 99.9/100: 100% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:35.415 shred Fluffy_Pillow 94.8/100: 95% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:36.419 healing_touch Fluffy_Pillow 89.7/100: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:37.174 rip Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, tigers_fury
0:38.177 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, tigers_fury
0:39.181 shred Fluffy_Pillow 79.9/100: 80% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, tigers_fury
0:40.185 wild_charge Fluffy_Pillow 54.8/100: 55% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, predatory_swiftness, tigers_fury
0:40.185 Waiting 0.400 sec 54.8/100: 55% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, wild_charge_movement, predatory_swiftness, tigers_fury
0:40.585 lunar_inspiration Fluffy_Pillow 60.8/100: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, wild_charge_movement, predatory_swiftness, tigers_fury
0:41.285 auto_attack Fluffy_Pillow 30.8/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
0:41.591 healing_touch Fluffy_Pillow 42.3/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
0:42.470 Waiting 3.200 sec 52.3/100: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
0:45.670 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
0:46.675 rake Fluffy_Pillow 75.4/100: 75% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
0:47.678 shred Fluffy_Pillow 51.8/100: 52% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
0:48.682 Waiting 1.548 sec 23.3/100: 23% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
0:50.230 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
0:51.235 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
0:52.114 Waiting 4.716 sec 22.5/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
0:56.830 rip Fluffy_Pillow 76.4/100: 76% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
0:57.837 rake Fluffy_Pillow 57.9/100: 58% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
0:58.843 lunar_inspiration Fluffy_Pillow 34.4/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
0:59.848 Waiting 2.195 sec 15.9/100: 16% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:02.043 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:03.048 Waiting 1.196 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:04.244 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:04.410 shred Fluffy_Pillow 88.0/100: 88% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:05.414 healing_touch Fluffy_Pillow 79.5/100: 80% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:06.293 rip Fluffy_Pillow 89.6/100: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, tigers_fury
1:07.299 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
1:08.303 shred Fluffy_Pillow 96.5/100: 96% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
1:09.308 lunar_inspiration Fluffy_Pillow 68.0/100: 68% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
1:10.312 healing_touch Fluffy_Pillow 49.4/100: 49% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
1:11.192 Waiting 2.600 sec 59.5/100: 59% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:13.792 ferocious_bite Fluffy_Pillow 89.2/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:14.798 rake Fluffy_Pillow 50.7/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:15.804 Waiting 1.200 sec 27.2/100: 27% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:17.004 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:18.007 Waiting 2.505 sec 12.4/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:20.512 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:21.516 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
1:22.395 Waiting 4.017 sec 22.5/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:26.412 rip Fluffy_Pillow 68.4/100: 68% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:27.418 ashamanes_frenzy Fluffy_Pillow 49.9/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:28.421 rake Fluffy_Pillow 61.4/100: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:29.426 lunar_inspiration Fluffy_Pillow 37.9/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:30.430 healing_touch Fluffy_Pillow 19.3/100: 19% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
1:31.310 Waiting 1.900 sec 29.4/100: 29% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:33.210 ferocious_bite Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:34.213 tigers_fury Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:34.410 rake Fluffy_Pillow 74.8/100: 75% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
1:35.414 shred Fluffy_Pillow 71.3/100: 71% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:36.418 shred Fluffy_Pillow 62.8/100: 63% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:37.422 shred Fluffy_Pillow 54.2/100: 54% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
1:38.427 healing_touch Fluffy_Pillow 25.7/100: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
1:39.307 Waiting 4.000 sec 35.8/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:43.307 rip Fluffy_Pillow 81.5/100: 81% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
1:44.312 rake Fluffy_Pillow 63.0/100: 63% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:45.315 lunar_inspiration Fluffy_Pillow 39.4/100: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
1:46.319 Waiting 1.758 sec 20.9/100: 21% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:48.077 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:49.082 Waiting 2.495 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:51.577 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:52.581 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
1:53.460 Waiting 0.217 sec 22.5/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
1:53.677 rip Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
1:54.680 rake Fluffy_Pillow 36.5/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:55.684 Waiting 1.556 sec 12.9/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:57.240 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:58.247 Waiting 2.518 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:00.765 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:01.769 Waiting 2.396 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:04.165 tigers_fury Fluffy_Pillow 39.8/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:04.410 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:05.290 wild_charge Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, bloodtalons(2), ashamanes_energy, tigers_fury
2:05.290 Waiting 1.000 sec 100.0/100: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, bloodtalons(2), ashamanes_energy, tigers_fury
2:06.290 auto_attack Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, bloodtalons(2), ashamanes_energy, tigers_fury
2:06.290 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, bloodtalons(2), ashamanes_energy, tigers_fury
2:07.294 rip Fluffy_Pillow 96.5/100: 96% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury
2:08.298 shred Fluffy_Pillow 97.9/100: 98% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
2:09.304 lunar_inspiration Fluffy_Pillow 69.4/100: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
2:10.310 shred Fluffy_Pillow 50.9/100: 51% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:11.316 healing_touch Fluffy_Pillow 22.4/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:12.195 Waiting 5.000 sec 32.5/100: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
2:17.195 ferocious_bite Fluffy_Pillow 89.6/100: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:18.199 rake Fluffy_Pillow 76.1/100: 76% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:19.204 shred Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:20.208 Waiting 1.400 sec 24.1/100: 24% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:21.608 shred Fluffy_Pillow 40.0/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:22.613 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
2:23.493 Waiting 3.298 sec 21.6/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
2:26.791 rip Fluffy_Pillow 59.3/100: 59% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
2:27.796 rake Fluffy_Pillow 40.8/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:28.801 Waiting 0.678 sec 17.2/100: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:29.479 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
2:30.482 Waiting 0.400 sec 36.5/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:30.882 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
2:31.883 healing_touch Fluffy_Pillow 52.5/100: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
2:32.760 ferocious_bite Fluffy_Pillow 62.5/100: 62% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:33.765 rake Fluffy_Pillow 49.0/100: 49% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:34.769 tigers_fury Fluffy_Pillow 25.4/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness
2:34.769 shred Fluffy_Pillow 85.4/100: 85% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
2:35.775 shred Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:36.781 shred Fluffy_Pillow 91.5/100: 91% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:37.786 shred Fluffy_Pillow 83.0/100: 83% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, tigers_fury
2:38.792 healing_touch Fluffy_Pillow 97.2/100: 97% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, acceleration
2:39.546 rip Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, acceleration
2:40.550 rake Fluffy_Pillow 84.2/100: 84% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, tigers_fury, acceleration
2:41.553 lunar_inspiration Fluffy_Pillow 63.4/100: 63% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, acceleration
2:42.558 healing_touch Fluffy_Pillow 47.7/100: 48% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, acceleration
2:43.312 ashamanes_frenzy Fluffy_Pillow 58.3/100: 58% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodtalons(2), acceleration
2:44.314 Waiting 1.000 sec 72.5/100: 73% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons, acceleration
2:45.314 ferocious_bite Fluffy_Pillow 86.7/100: 87% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons, acceleration
2:46.320 shred Fluffy_Pillow 50.9/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
2:47.323 Waiting 1.200 sec 25.1/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
2:48.523 shred Fluffy_Pillow 40.1/100: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
2:49.528 Waiting 2.371 sec 11.6/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:51.899 shred Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, acceleration
2:52.903 healing_touch Fluffy_Pillow 14.4/100: 14% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, acceleration
2:53.658 rip Fluffy_Pillow 25.1/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), acceleration
2:54.663 rake Fluffy_Pillow 39.4/100: 39% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, acceleration
2:55.668 Waiting 0.851 sec 18.6/100: 19% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
2:56.519 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
2:57.524 Waiting 1.814 sec 14.9/100: 15% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, acceleration
2:59.338 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, acceleration
3:00.345 Waiting 1.617 sec 14.8/100: 15% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, acceleration
3:01.962 incarnation Fluffy_Pillow 36.1/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
3:02.841 shred Fluffy_Pillow 46.1/150: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:03.845 healing_touch Fluffy_Pillow 37.6/150: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:04.725 tigers_fury Fluffy_Pillow 47.6/150: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct
3:04.769 rip Fluffy_Pillow 108.1/150: 72% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, ashamanes_energy, tigers_fury
3:05.774 rake Fluffy_Pillow 124.6/150: 83% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:06.780 shred Fluffy_Pillow 138.6/150: 92% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:07.785 lunar_inspiration Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:08.790 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:09.795 healing_touch Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:10.673 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, tigers_fury
3:11.677 rake Fluffy_Pillow 136.5/150: 91% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness, tigers_fury
3:12.683 shred Fluffy_Pillow 130.5/150: 87% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:13.690 shred Fluffy_Pillow 122.0/150: 81% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:14.694 healing_touch Fluffy_Pillow 113.5/150: 76% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:15.573 ferocious_bite Fluffy_Pillow 123.5/150: 82% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct
3:16.577 shred Fluffy_Pillow 110.0/150: 73% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness
3:17.581 shred Fluffy_Pillow 101.4/150: 68% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:18.585 shred Fluffy_Pillow 92.9/150: 62% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:19.588 healing_touch Fluffy_Pillow 84.4/150: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:20.468 rip Fluffy_Pillow 94.4/150: 63% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2)
3:21.473 rake Fluffy_Pillow 90.9/150: 61% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness
3:22.477 lunar_inspiration Fluffy_Pillow 84.9/150: 57% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:23.481 shred Fluffy_Pillow 81.4/150: 54% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:24.484 shred Fluffy_Pillow 72.8/150: 49% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:25.489 healing_touch Fluffy_Pillow 64.3/150: 43% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:26.369 ferocious_bite Fluffy_Pillow 74.4/150: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2)
3:27.374 shred Fluffy_Pillow 60.9/150: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness
3:28.378 shred Fluffy_Pillow 52.3/150: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness
3:29.382 shred Fluffy_Pillow 63.8/150: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:30.386 wild_charge Fluffy_Pillow 55.3/150: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, incarnation_king_of_the_jungle, predatory_swiftness
3:30.386 healing_touch Fluffy_Pillow 55.3/150: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, predatory_swiftness
3:31.263 Waiting 0.100 sec 65.3/150: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, bloodtalons(2)
3:31.363 auto_attack Fluffy_Pillow 66.4/150: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, incarnation_king_of_the_jungle, bloodtalons(2)
3:31.363 ferocious_bite Fluffy_Pillow 66.4/150: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, incarnation_king_of_the_jungle, bloodtalons(2)
3:32.369 shred Fluffy_Pillow 52.9/100: 53% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:33.371 Waiting 1.200 sec 24.4/100: 24% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
3:34.571 tigers_fury Fluffy_Pillow 38.1/100: 38% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
3:34.769 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:35.772 lunar_inspiration Fluffy_Pillow 96.5/100: 96% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:36.775 shred Fluffy_Pillow 97.9/100: 98% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:37.778 healing_touch Fluffy_Pillow 89.4/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
3:38.657 rip Fluffy_Pillow 99.4/100: 99% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
3:39.661 rake Fluffy_Pillow 80.9/100: 81% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, tigers_fury
3:40.666 shred Fluffy_Pillow 57.4/100: 57% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
3:41.669 Waiting 1.000 sec 28.9/100: 29% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
3:42.669 shred Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
3:43.673 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
3:44.553 Waiting 4.979 sec 21.8/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
3:49.532 rip Fluffy_Pillow 78.7/100: 79% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
3:50.537 rake Fluffy_Pillow 90.2/100: 90% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:51.542 lunar_inspiration Fluffy_Pillow 66.7/100: 67% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
3:52.547 shred Fluffy_Pillow 48.2/100: 48% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
3:53.552 healing_touch Fluffy_Pillow 19.6/100: 20% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
3:54.432 Waiting 5.200 sec 29.7/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
3:59.632 ferocious_bite Fluffy_Pillow 89.1/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:00.637 ashamanes_frenzy Fluffy_Pillow 75.6/100: 76% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:01.642 shred Fluffy_Pillow 87.1/100: 87% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:02.645 healing_touch Fluffy_Pillow 58.6/100: 59% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
4:03.523 rip Fluffy_Pillow 68.6/100: 69% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:04.528 rake Fluffy_Pillow 80.1/100: 80% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:05.533 lunar_inspiration Fluffy_Pillow 56.6/100: 57% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:06.537 tigers_fury Fluffy_Pillow 38.0/100: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:06.537 shred Fluffy_Pillow 98.0/100: 98% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:07.542 shred Fluffy_Pillow 89.5/100: 90% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:08.548 healing_touch Fluffy_Pillow 81.0/100: 81% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
4:09.428 rip Fluffy_Pillow 91.1/100: 91% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, tigers_fury
4:10.433 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, tigers_fury
4:11.438 shred Fluffy_Pillow 76.5/100: 76% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
4:12.443 shred Fluffy_Pillow 48.0/100: 48% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
4:13.447 Waiting 0.886 sec 19.4/100: 19% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
4:14.333 shred Fluffy_Pillow 29.6/100: 30% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury
4:15.337 healing_touch Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:16.218 Waiting 3.300 sec 51.1/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:19.518 ferocious_bite Fluffy_Pillow 88.8/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:20.524 rake Fluffy_Pillow 75.3/100: 75% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:21.529 lunar_inspiration Fluffy_Pillow 51.8/100: 52% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:22.534 shred Fluffy_Pillow 33.3/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
4:23.537 shred Fluffy_Pillow 44.7/100: 45% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
4:24.542 healing_touch Fluffy_Pillow 56.2/100: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:25.422 Waiting 2.000 sec 66.3/100: 66% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:27.422 rip Fluffy_Pillow 89.1/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:28.425 rake Fluffy_Pillow 70.6/100: 71% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:29.429 shred Fluffy_Pillow 47.1/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
4:30.435 Waiting 1.062 sec 18.6/100: 19% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:31.497 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:32.502 Waiting 2.520 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:35.022 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:36.025 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:36.906 tigers_fury Fluffy_Pillow 22.5/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:36.906 Waiting 0.600 sec 82.5/100: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:37.506 rip Fluffy_Pillow 89.4/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:38.512 rake Fluffy_Pillow 90.9/100: 91% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
4:39.515 shred Fluffy_Pillow 87.3/100: 87% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:40.522 shred Fluffy_Pillow 78.8/100: 79% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
4:41.526 healing_touch Fluffy_Pillow 50.3/100: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
4:42.404 Waiting 2.500 sec 60.4/100: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:44.904 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:45.908 rake Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:46.912 Waiting 0.300 sec 26.9/100: 27% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:47.212 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:48.218 Waiting 2.555 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:50.773 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:51.776 Waiting 2.497 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:54.273 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:55.278 wild_charge Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness
4:55.278 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness
4:56.157 Waiting 0.217 sec 22.5/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, bloodtalons(2)
4:56.374 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:56.374 Waiting 1.100 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
4:57.474 rip Fluffy_Pillow 37.6/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
5:00.011 rake Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
5:01.014 Waiting 1.547 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:02.561 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:03.565 shred Fluffy_Pillow 12.2/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
5:04.571 healing_touch Fluffy_Pillow 23.7/100: 24% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
5:05.450 ferocious_bite Fluffy_Pillow 33.7/100: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
5:06.710 tigers_fury Fluffy_Pillow 23.1/100: 23% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
5:06.906 rake Fluffy_Pillow 85.4/100: 85% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
5:07.909 shred Fluffy_Pillow 81.8/100: 82% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:08.914 shred Fluffy_Pillow 73.3/100: 73% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:09.918 healing_touch Fluffy_Pillow 64.8/100: 65% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:10.715 Waiting 0.800 sec 74.8/100: 75% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, acceleration
5:11.515 ferocious_bite Fluffy_Pillow 86.1/100: 86% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, acceleration
5:12.518 shred Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, tigers_fury, acceleration
5:13.523 Waiting 0.400 sec 24.6/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, acceleration
5:13.923 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, acceleration
5:14.929 healing_touch Fluffy_Pillow 14.5/100: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, acceleration
5:15.685 ashamanes_frenzy Fluffy_Pillow 25.2/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodtalons(2), acceleration
5:16.689 Waiting 3.300 sec 39.4/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons, acceleration
5:19.989 ferocious_bite Fluffy_Pillow 86.2/100: 86% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons, acceleration
5:20.993 rake Fluffy_Pillow 73.7/100: 74% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:21.996 shred Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:22.999 Waiting 1.696 sec 21.6/100: 22% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:24.695 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:25.699 Waiting 1.696 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:27.395 lunar_inspiration Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:28.399 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:29.277 Waiting 4.543 sec 23.4/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
5:33.820 ferocious_bite Fluffy_Pillow 86.1/100: 86% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2), acceleration
5:34.825 rake Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, acceleration
5:35.829 Waiting 0.800 sec 29.6/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
5:36.629 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
5:37.633 tigers_fury Fluffy_Pillow 15.1/100: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, acceleration
5:37.633 shred Fluffy_Pillow 75.1/100: 75% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:38.638 shred Fluffy_Pillow 69.4/100: 69% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:39.643 healing_touch Fluffy_Pillow 63.6/100: 64% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:40.528 rip Fluffy_Pillow 74.3/100: 74% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, tigers_fury
5:41.532 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, tigers_fury
5:42.536 lunar_inspiration Fluffy_Pillow 76.5/100: 76% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
5:43.541 shred Fluffy_Pillow 58.0/100: 58% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury
5:44.546 shred Fluffy_Pillow 69.4/100: 69% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:45.550 healing_touch Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:46.431 Waiting 3.300 sec 51.0/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
5:49.731 ferocious_bite Fluffy_Pillow 88.7/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodtalons(2)
5:50.735 rake Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
5:51.740 Waiting 1.200 sec 26.7/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:52.940 shred Fluffy_Pillow 40.4/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:53.945 Waiting 1.650 sec 11.9/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:55.595 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:56.599 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:57.477 Waiting 4.243 sec 22.2/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
6:01.720 incarnation Fluffy_Pillow 70.7/100: 71% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
6:02.842 potion Fluffy_Pillow 83.5/150: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct
6:02.842 ferocious_bite Fluffy_Pillow 83.5/150: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, potion_of_the_old_war
6:03.847 rake Fluffy_Pillow 82.5/150: 55% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:04.853 shred Fluffy_Pillow 76.5/150: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:05.859 shred Fluffy_Pillow 68.0/150: 45% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:06.864 healing_touch Fluffy_Pillow 59.5/150: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:07.743 tigers_fury Fluffy_Pillow 69.5/150: 46% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, potion_of_the_old_war
6:07.743 ferocious_bite Fluffy_Pillow 129.5/150: 86% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
6:08.748 rake Fluffy_Pillow 136.0/150: 91% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:09.753 lunar_inspiration Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:10.756 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:11.762 shred Fluffy_Pillow 141.5/150: 94% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:12.766 healing_touch Fluffy_Pillow 133.0/150: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:13.647 ferocious_bite Fluffy_Pillow 143.0/150: 95% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), feral_instinct, tigers_fury, potion_of_the_old_war
6:14.652 shred Fluffy_Pillow 129.5/150: 86% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:15.657 shred Fluffy_Pillow 121.0/150: 81% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:16.661 shred Fluffy_Pillow 112.5/150: 75% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:17.665 healing_touch Fluffy_Pillow 104.0/150: 69% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:18.543 ferocious_bite Fluffy_Pillow 114.0/150: 76% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2), potion_of_the_old_war
6:19.547 rake Fluffy_Pillow 100.5/150: 67% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, potion_of_the_old_war
6:20.552 shred Fluffy_Pillow 94.4/150: 63% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:21.558 shred Fluffy_Pillow 105.9/150: 71% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:22.563 healing_touch Fluffy_Pillow 97.4/150: 65% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:23.443 ferocious_bite Fluffy_Pillow 107.5/150: 72% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, bloodtalons(2), potion_of_the_old_war
6:24.445 lunar_inspiration Fluffy_Pillow 106.4/150: 71% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, potion_of_the_old_war
6:25.449 rake Fluffy_Pillow 102.9/150: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness, potion_of_the_old_war
6:26.451 shred Fluffy_Pillow 96.9/150: 65% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:27.455 shred Fluffy_Pillow 88.3/150: 59% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:28.460 healing_touch Fluffy_Pillow 79.8/150: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness
6:29.340 ferocious_bite Fluffy_Pillow 89.9/150: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, bloodtalons(2)
6:30.345 shred Fluffy_Pillow 76.4/150: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, bloodtalons, predatory_swiftness
6:31.350 healing_touch Fluffy_Pillow 67.8/150: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness
6:32.231 ashamanes_frenzy Fluffy_Pillow 77.9/100: 78% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodtalons(2)
6:33.234 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons
6:34.237 shred Fluffy_Pillow 75.8/100: 76% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
6:35.240 shred Fluffy_Pillow 87.3/100: 87% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
6:36.244 shred Fluffy_Pillow 58.8/100: 59% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:37.247 healing_touch Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
6:38.125 ferocious_bite Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
6:39.129 tigers_fury Fluffy_Pillow 26.7/100: 27% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
6:39.129 rake Fluffy_Pillow 86.7/100: 87% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
6:40.134 shred Fluffy_Pillow 83.2/100: 83% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
6:41.138 shred Fluffy_Pillow 74.7/100: 75% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
6:42.145 lunar_inspiration Fluffy_Pillow 66.2/100: 66% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
6:43.149 healing_touch Fluffy_Pillow 47.7/100: 48% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 25047 23341 13202 (11648)
Stamina 34939 34939 20980
Intellect 7651 7326 0
Spirit 0 0 0
Health 2096340 2096340 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 30056 28009 0
Crit 32.67% 32.67% 6184
Haste 14.28% 14.28% 4640
Damage / Heal Versatility 5.70% 5.70% 2279
Attack Power 25047 23341 0
Mastery 67.50% 65.34% 8636
Armor 2120 2120 2120
Run Speed 10 0 0
Leech 1.76% 1.76% 404

Gear

Source Slot Average Item Level: 858.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Strand of the Stars
ilevel: 840, stats: { +997 Sta, +960 Vers, +808 Mastery }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }, gems: { +150 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Biornskin Bracer
ilevel: 850, stats: { 144 Armor, +729 AgiInt, +1094 Sta, +498 Crit, +236 Mastery }
Local Hands Raven's Veil Gloves
ilevel: 855, stats: { 209 Armor, +1019 AgiInt, +1529 Sta, +627 Mastery, +370 Crit }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +150 Mastery }
Local Finger2 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }, enchant: { +150 Mastery }
Local Trinket1 Chrono Shard
ilevel: 840, stats: { +1123 StrAgiInt, +404 Leech }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Nightborne Noble's Cloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +483 Mastery, +237 Haste }, gems: { +150 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +40 ilevels, +42 ilevels, +43 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=711/herbalism=815
talents=http://us.battle.net/wow/en/tool/talent-calculator#UZ!2200111
artifact=58:0:0:0:0:1153:1:1154:1:1156:1:1157:1:1158:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:1:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=strand_of_the_stars,id=137487,bonus_id=1727/1492/1813
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1808/1472,gems=150mastery
back=nightborne_nobles_cloak,id=134290,bonus_id=3397/1808/1507/3337,gems=150mastery,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=biornskin_bracer,id=134192,bonus_id=1727/1512/3336
hands=ravens_veil_gloves,id=139242,bonus_id=3411/1507/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1727/1492/1813,enchant=150mastery
finger2=mindrend_band,id=138220,bonus_id=1807/1472,enchant=150mastery
trinket1=chrono_shard,id=137419,bonus_id=1727/41/1492/1813
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/133687/139249/0,relic_id=1727:1492:1813/1727:1497:3336/1807:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=858.13
# gear_agility=13202
# gear_stamina=20980
# gear_crit_rating=6184
# gear_haste_rating=3093
# gear_mastery_rating=8636
# gear_versatility_rating=2279
# gear_leech_rating=404
# gear_armor=2120
# set_bonus=journey_through_time_2pc=1

Rothlandra

Rothlandra : 234163 dps

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
234162.7 234162.7 4433.7 / 1.893% 19394.5 / 8.3% 14031.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.7 16.7 Focus 15.65% 33.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 226
  • herbalism: 232

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 234163
Aimed Shot 101696 43.5% 101.8 3.95sec 397063 248142 Direct 101.8 261402 597154 393522 40.0%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.78 101.78 0.00 0.00 1.6001 0.0000 40412165.84 59409711.73 31.98 248142.05 248142.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.11 60.04% 261402.46 105111 262777 261269.44 256937 262777 15970995 23478876 31.98
crit 40.67 39.96% 597154.18 220733 840886 600148.25 556235 622489 24441170 35930836 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.15
 
auto_shot 12129 5.2% 145.4 2.71sec 33061 12173 Direct 145.4 24164 52045 33130 31.7%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.44 145.44 0.00 0.00 2.7160 0.0000 4808570.46 7069054.06 31.98 12172.73 12172.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.33 68.30% 24163.67 24164 24164 24163.67 24164 24164 2400258 3528607 31.98
crit 46.11 31.70% 52044.83 48327 72491 52198.63 50785 53798 2408313 3540448 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 33771 14.4% 18.0 22.50sec 743462 263390 Periodic 287.6 34921 73557 47243 31.1% 11.7%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.00 0.00 287.56 287.56 2.8227 0.1611 13382318.07 19673275.17 31.98 263389.98 263389.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 198.2 68.93% 34920.52 34921 34921 34920.52 34921 34921 6922022 10176029 31.98
crit 89.3 31.07% 73556.60 69841 104762 72404.39 70247 75737 6460296 9497246 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 10434 4.4% 30.9 13.39sec 131965 0 Direct 30.9 81344 207586 129586 39.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.89 30.89 0.00 0.00 0.0000 0.0000 4076254.23 4076254.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 60.43% 81344.32 81344 81344 81344.32 81344 81344 1518427 1518427 0.00
crit 12.22 39.57% 207586.48 162689 244033 208813.10 198842 219630 2557827 2557827 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 37250 15.9% 35.3 10.81sec 418217 334602 Direct 35.3 301236 664153 417776 32.7%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.33 35.33 0.00 0.00 1.2499 0.0000 14777016.84 21723614.47 31.98 334601.74 334601.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.78 67.30% 301236.23 123313 308283 300864.31 280537 308283 7165860 10534493 31.98
crit 11.56 32.70% 664152.64 246626 924848 657583.79 610400 719326 7611157 11189122 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=25}%.$?a190529[ Aimed Shot critical strike chance increased by {$s3=0}%.][] Lasts $6d. Stacks up to {$u=3} times.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 3598 1.5% 17.1 24.82sec 84037 0 Periodic 84.7 16986 0 16986 0.0% 5.3%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.11 0.00 84.67 84.67 0.0000 0.2499 1437973.19 1437973.19 0.00 67960.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.7 100.00% 16985.89 12369 16990 16986.11 16955 16990 1437973 1437973 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 13815 5.9% 40.1 9.85sec 136787 108969 Direct 40.1 98171 215862 136578 33.0%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.11 40.11 0.00 0.00 1.2553 0.0000 5486693.68 5486693.68 0.00 108968.91 108968.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.89 67.04% 98171.46 98171 98171 98171.46 98171 98171 2639721 2639721 0.00
crit 13.22 32.96% 215862.39 196343 294514 215720.88 203895 235611 2846972 2846972 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 21470 9.2% 17.6 22.23sec 486235 372172 Direct 18.6 349205 759142 467555 26.3%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.56 18.56 0.00 0.00 1.3065 0.0000 8536126.34 12548914.29 31.98 372171.54 372171.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 73.65% 349205.17 349205 349205 349205.17 349205 349205 4772471 7015984 31.98
crit 4.89 26.35% 759141.67 698410 1047616 768343.75 698410 814812 3763656 5532930 31.98
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.7 90.67sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.6 178.20sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:170.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 46.25% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 118.1 0.0sec 0.6sec 18.52% 54.36% 89.1(89.1) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.30%
  • bullseye_2:0.18%
  • bullseye_3:0.25%
  • bullseye_4:0.35%
  • bullseye_5:0.28%
  • bullseye_6:0.22%
  • bullseye_7:0.21%
  • bullseye_8:0.15%
  • bullseye_9:0.18%
  • bullseye_10:0.14%
  • bullseye_11:0.16%
  • bullseye_12:0.12%
  • bullseye_13:0.17%
  • bullseye_14:0.08%
  • bullseye_15:0.09%
  • bullseye_16:0.09%
  • bullseye_17:0.10%
  • bullseye_18:0.05%
  • bullseye_19:0.07%
  • bullseye_20:0.05%
  • bullseye_21:0.07%
  • bullseye_22:0.06%
  • bullseye_23:0.07%
  • bullseye_24:0.13%
  • bullseye_25:0.16%
  • bullseye_26:0.16%
  • bullseye_27:0.08%
  • bullseye_28:0.07%
  • bullseye_29:0.21%
  • bullseye_30:14.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 9.7 0.2 36.7sec 35.5sec 7.33% 10.56% 0.2(0.2) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.40%
  • lock_and_load_2:2.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 34.1 10.0 11.7sec 8.9sec 35.31% 61.77% 10.0(10.0) 0.1

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:35.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 336.3sec 0.0sec 14.87% 51.46% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 7.32% 39.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:7.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.6 0.0 200.8sec 191.0sec 9.60% 19.29% 0.0(0.0) 2.6

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.6 0.0 200.8sec 191.0sec 9.60% 31.01% 0.0(0.0) 2.6

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 101.9 4080.8 40.0 40.1 9903.1
barrage Focus 18.2 1089.2 60.0 60.5 12286.0
marked_shot Focus 35.7 1070.8 30.0 30.3 13800.4
windburst Focus 18.5 370.8 20.0 21.1 23022.7
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.77 71.54 (1.10%) 15.00 0.00 0.00%
sidewinders Focus 40.31 1947.12 (29.84%) 48.31 68.26 3.39%
focus_regen Focus 1453.54 4506.32 (69.06%) 3.10 224.15 4.74%
Resource RPS-Gain RPS-Loss
Focus 16.48 16.70
Combat End Resource Mean Min Max
Focus 51.21 40.45 61.98

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 3.5%

Procs

Count Interval
starved: barrage 283.3 2.3sec
lock_and_load 9.9 35.5sec
no_vuln_aimed_shot 1.4 71.3sec
no_vuln_marked_shot 1.6 88.7sec
marking_targets 44.1 8.9sec
wasted_marking_targets 10.0 34.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Rothlandra Damage Per Second
Count 9
Mean 234162.73
Minimum 222101.77
Maximum 244987.59
Spread ( max - min ) 22885.82
Range [ ( max - min ) / 2 * 100% ] 4.89%
Standard Deviation 6786.4423
5th Percentile 222101.77
95th Percentile 241496.27
( 95th Percentile - 5th Percentile ) 19394.50
Mean Distribution
Standard Deviation 2262.1474
95.00% Confidence Intervall ( 229729.00 - 238596.46 )
Normalized 95.00% Confidence Intervall ( 98.11% - 101.89% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3226
0.1 Scale Factor Error with Delta=300 393158
0.05 Scale Factor Error with Delta=300 1572635
0.01 Scale Factor Error with Delta=300 39315878
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9
Mean 234162.73
Minimum 222101.77
Maximum 244987.59
Spread ( max - min ) 22885.82
Range [ ( max - min ) / 2 * 100% ] 4.89%
Standard Deviation 6786.4423
5th Percentile 222101.77
95th Percentile 241496.27
( 95th Percentile - 5th Percentile ) 19394.50
Mean Distribution
Standard Deviation 2262.1474
95.00% Confidence Intervall ( 229729.00 - 238596.46 )
Normalized 95.00% Confidence Intervall ( 98.11% - 101.89% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3226
0.1 Scale Factor Error with Delta=300 393158
0.05 Scale Factor Error with Delta=300 1572635
0.01 Scale Factor Error with Delta=300 39315878
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9
Mean 234162.73
Minimum 222101.77
Maximum 244987.59
Spread ( max - min ) 22885.82
Range [ ( max - min ) / 2 * 100% ] 4.89%
Damage
Sample Data Rothlandra Damage
Count 9
Mean 92917118.66
Minimum 76585358.32
Maximum 116579011.92
Spread ( max - min ) 39993653.60
Range [ ( max - min ) / 2 * 100% ] 21.52%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 4.77 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
9 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
A 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
B 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
C 6.54 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
D 10.62 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
E 17.62 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
F 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
G 10.31 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
H 57.38 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
I 34.85 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
J 28.08 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
K 4.31 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
L 26.15 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
M 1.23 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
N 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
O 1.69 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
P 1.00 trueshot
Q 1.46 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
R 2.85 marked_shot
S 1.23 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
T 1.00 barrage
U 7.69 aimed_shot,if=execute_time<debuff.vulnerability.remains
V 1.62 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
W 0.46 marked_shot
0.00 windburst
X 1.54 aimed_shot,if=execute_time<debuff.vulnerability.remains
Y 0.85 sidewinders
Z 0.08 aimed_shot
0.00 arcane_shot

Sample Sequence

04567PTUQRU8UUUQRUVRUUVHHEDKLHHJLHHJLHHJCLEHHHJLHHJLDEHHJLHHJILDEH8HHJILHDJEIGIILJCIEIIIGHHKICGHHEHHKGHHHOJCGHHJGHEHJGHH8JICGEIILHHJCGHEHHKLHHJLDHEHHJIGIILHDJLEHHJLH8HJICEILKILHHJCEIIIGHHKILHDJLEHHHJILHHJLNDOHEHHHHJGHHJ8ILDEHHKLHHJLHHJEXX

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.069 aimed_shot Fluffy_Pillow 107.5/150: 72% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.065 sidewinders Fluffy_Pillow 77.6/150: 52% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.820 marked_shot Fluffy_Pillow 142.8/150: 95% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:04.574 aimed_shot Fluffy_Pillow 128.0/150: 85% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.570 arcane_torrent Fluffy_Pillow 98.1/150: 65% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.570 aimed_shot Fluffy_Pillow 113.1/150: 75% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.566 aimed_shot Fluffy_Pillow 83.2/150: 55% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.563 aimed_shot Fluffy_Pillow 53.3/150: 36% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.559 sidewinders Fluffy_Pillow 23.4/150: 16% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.312 marked_shot Fluffy_Pillow 88.6/150: 59% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.067 aimed_shot Fluffy_Pillow 73.8/150: 49% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:11.064 sidewinders Fluffy_Pillow 43.9/150: 29% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:11.819 marked_shot Fluffy_Pillow 109.1/150: 73% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:12.573 aimed_shot Fluffy_Pillow 94.3/150: 63% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:13.569 aimed_shot Fluffy_Pillow 64.4/150: 43% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:14.565 Waiting 0.200 sec 34.5/150: 23% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.765 sidewinders Fluffy_Pillow 38.5/150: 26% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.726 aimed_shot Fluffy_Pillow 103.7/150: 69% focus bloodlust, potion_of_deadly_grace
0:17.120 aimed_shot Fluffy_Pillow 73.8/150: 49% focus bloodlust, potion_of_deadly_grace
0:18.514 Waiting 1.300 sec 43.9/150: 29% focus bloodlust, potion_of_deadly_grace
0:19.814 windburst Fluffy_Pillow 62.6/150: 42% focus bloodlust, potion_of_deadly_grace
0:21.046 barrage Fluffy_Pillow 60.3/150: 40% focus bloodlust, potion_of_deadly_grace
0:23.347 Waiting 0.300 sec 33.5/150: 22% focus bloodlust, potion_of_deadly_grace
0:23.647 marked_shot Fluffy_Pillow 37.8/150: 25% focus bloodlust, marking_targets, potion_of_deadly_grace
0:24.692 sidewinders Fluffy_Pillow 22.8/150: 15% focus bloodlust, marking_targets, potion_of_deadly_grace
0:25.738 aimed_shot Fluffy_Pillow 87.9/150: 59% focus bloodlust, potion_of_deadly_grace
0:27.129 aimed_shot Fluffy_Pillow 57.9/150: 39% focus bloodlust, potion_of_deadly_grace
0:28.521 Waiting 1.200 sec 28.0/150: 19% focus bloodlust
0:29.721 marked_shot Fluffy_Pillow 45.2/150: 30% focus bloodlust
0:30.766 sidewinders Fluffy_Pillow 30.3/150: 20% focus bloodlust, marking_targets
0:31.810 aimed_shot Fluffy_Pillow 95.3/150: 64% focus bloodlust
0:33.203 aimed_shot Fluffy_Pillow 65.4/150: 44% focus bloodlust, marking_targets
0:34.596 Waiting 1.200 sec 35.4/150: 24% focus bloodlust, marking_targets
0:35.796 marked_shot Fluffy_Pillow 52.7/150: 35% focus bloodlust, marking_targets
0:36.841 sidewinders Fluffy_Pillow 37.8/150: 25% focus bloodlust, marking_targets
0:37.886 aimed_shot Fluffy_Pillow 102.8/150: 69% focus bloodlust
0:39.279 aimed_shot Fluffy_Pillow 72.9/150: 49% focus bloodlust
0:40.324 Waiting 1.600 sec 87.9/150: 59% focus bloodlust, raid_movement
0:41.924 marked_shot Fluffy_Pillow 107.7/150: 72% focus raid_movement
0:43.280 barrage Fluffy_Pillow 92.7/150: 62% focus raid_movement
0:46.280 Waiting 0.300 sec 65.9/150: 44% focus raid_movement
0:46.580 sidewinders Fluffy_Pillow 69.2/150: 46% focus raid_movement, marking_targets
0:47.939 windburst Fluffy_Pillow 134.3/150: 90% focus
0:49.297 aimed_shot Fluffy_Pillow 129.3/150: 86% focus marking_targets
0:51.107 aimed_shot Fluffy_Pillow 99.4/150: 66% focus marking_targets
0:52.917 aimed_shot Fluffy_Pillow 69.4/150: 46% focus marking_targets
0:54.725 marked_shot Fluffy_Pillow 39.5/150: 26% focus marking_targets
0:56.084 sidewinders Fluffy_Pillow 24.5/150: 16% focus marking_targets
0:57.443 aimed_shot Fluffy_Pillow 89.6/150: 60% focus
0:59.251 aimed_shot Fluffy_Pillow 59.6/150: 40% focus
1:01.060 Waiting 0.100 sec 29.6/150: 20% focus
1:01.160 marked_shot Fluffy_Pillow 30.7/150: 20% focus
1:02.518 Waiting 3.200 sec 15.8/150: 11% focus
1:05.718 sidewinders Fluffy_Pillow 51.2/150: 34% focus marking_targets
1:07.321 barrage Fluffy_Pillow 119.0/150: 79% focus
1:10.318 windburst Fluffy_Pillow 92.2/150: 61% focus
1:11.676 aimed_shot Fluffy_Pillow 87.2/150: 58% focus marking_targets
1:13.486 aimed_shot Fluffy_Pillow 57.3/150: 38% focus marking_targets
1:15.296 Waiting 1.400 sec 27.3/150: 18% focus marking_targets
1:16.696 marked_shot Fluffy_Pillow 42.8/150: 29% focus marking_targets
1:18.054 sidewinders Fluffy_Pillow 27.9/150: 19% focus marking_targets
1:19.413 aimed_shot Fluffy_Pillow 92.9/150: 62% focus
1:21.223 aimed_shot Fluffy_Pillow 63.0/150: 42% focus
1:23.031 Waiting 0.100 sec 33.0/150: 22% focus
1:23.131 marked_shot Fluffy_Pillow 34.1/150: 23% focus
1:24.490 Waiting 2.800 sec 19.2/150: 13% focus marking_targets
1:27.290 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets
1:29.100 sidewinders Fluffy_Pillow 20.2/150: 13% focus marking_targets
1:30.459 barrage Fluffy_Pillow 85.3/150: 57% focus
1:33.362 windburst Fluffy_Pillow 57.5/150: 38% focus
1:34.719 aimed_shot Fluffy_Pillow 52.5/150: 35% focus lock_and_load(2)
1:36.077 arcane_torrent Fluffy_Pillow 67.5/150: 45% focus lock_and_load
1:36.077 aimed_shot Fluffy_Pillow 82.5/150: 55% focus lock_and_load
1:37.435 aimed_shot Fluffy_Pillow 97.6/150: 65% focus
1:39.246 Waiting 0.500 sec 67.6/150: 45% focus
1:39.746 marked_shot Fluffy_Pillow 73.2/150: 49% focus
1:41.104 aimed_shot Fluffy_Pillow 58.2/150: 39% focus
1:42.914 Waiting 4.300 sec 28.3/150: 19% focus
1:47.214 sidewinders Fluffy_Pillow 75.9/150: 51% focus marking_targets
1:48.573 aimed_shot Fluffy_Pillow 141.0/150: 94% focus
1:50.384 barrage Fluffy_Pillow 100.1/150: 67% focus
1:53.397 marked_shot Fluffy_Pillow 73.4/150: 49% focus
1:54.757 windburst Fluffy_Pillow 58.5/150: 39% focus
1:56.113 aimed_shot Fluffy_Pillow 53.5/150: 36% focus
1:57.923 Waiting 1.200 sec 23.6/150: 16% focus
1:59.123 sidewinders Fluffy_Pillow 36.9/150: 25% focus
2:00.481 aimed_shot Fluffy_Pillow 101.9/150: 68% focus
2:02.290 aimed_shot Fluffy_Pillow 72.0/150: 48% focus marking_targets
2:04.100 sidewinders Fluffy_Pillow 42.0/150: 28% focus marking_targets
2:05.459 Waiting 3.700 sec 107.1/150: 71% focus raid_movement
2:09.159 marked_shot Fluffy_Pillow 148.0/150: 99% focus raid_movement
2:10.519 barrage Fluffy_Pillow 133.1/150: 89% focus raid_movement, lock_and_load(2)
2:13.450 aimed_shot Fluffy_Pillow 105.6/150: 70% focus lock_and_load(2)
2:14.809 Waiting 1.100 sec 120.6/150: 80% focus lock_and_load, marking_targets
2:15.909 windburst Fluffy_Pillow 132.8/150: 89% focus lock_and_load, marking_targets
2:17.469 aimed_shot Fluffy_Pillow 130.0/150: 87% focus lock_and_load, marking_targets
2:18.830 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
2:20.639 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
2:22.449 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
2:23.809 aimed_shot Fluffy_Pillow 135.2/150: 90% focus
2:25.617 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
2:27.428 marked_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
2:28.784 aimed_shot Fluffy_Pillow 55.1/150: 37% focus marking_targets
2:30.591 barrage Fluffy_Pillow 75.1/150: 50% focus lock_and_load, marking_targets
2:33.448 sidewinders Fluffy_Pillow 46.8/150: 31% focus lock_and_load, marking_targets
2:34.806 aimed_shot Fluffy_Pillow 111.8/150: 75% focus lock_and_load, marking_targets
2:36.163 aimed_shot Fluffy_Pillow 126.9/150: 85% focus marking_targets
2:37.971 windburst Fluffy_Pillow 96.9/150: 65% focus marking_targets
2:39.329 aimed_shot Fluffy_Pillow 91.9/150: 61% focus marking_targets
2:41.138 aimed_shot Fluffy_Pillow 62.0/150: 41% focus marking_targets
2:42.948 marked_shot Fluffy_Pillow 32.0/150: 21% focus marking_targets
2:44.306 sidewinders Fluffy_Pillow 17.1/150: 11% focus marking_targets
2:45.664 aimed_shot Fluffy_Pillow 82.1/150: 55% focus lock_and_load(2), marking_targets
2:47.021 aimed_shot Fluffy_Pillow 97.1/150: 65% focus lock_and_load, marking_targets
2:48.380 aimed_shot Fluffy_Pillow 112.2/150: 75% focus marking_targets
2:50.189 trueshot Fluffy_Pillow 82.2/150: 55% focus marking_targets
2:50.189 marked_shot Fluffy_Pillow 82.2/150: 55% focus marking_targets, rapid_killing, trueshot
2:51.161 barrage Fluffy_Pillow 67.3/150: 45% focus marking_targets, rapid_killing, trueshot
2:53.421 sidewinders Fluffy_Pillow 42.4/150: 28% focus marking_targets, rapid_killing, trueshot
2:54.393 aimed_shot Fluffy_Pillow 107.4/150: 72% focus marking_targets, rapid_killing, trueshot
2:55.687 aimed_shot Fluffy_Pillow 77.5/150: 52% focus marking_targets, rapid_killing, trueshot
2:56.980 marked_shot Fluffy_Pillow 47.5/150: 32% focus marking_targets, rapid_killing, trueshot
2:57.952 sidewinders Fluffy_Pillow 32.6/150: 22% focus marking_targets, rapid_killing, trueshot
2:58.924 aimed_shot Fluffy_Pillow 97.7/150: 65% focus rapid_killing, trueshot
3:00.217 windburst Fluffy_Pillow 67.8/150: 45% focus marking_targets, rapid_killing, trueshot
3:01.188 aimed_shot Fluffy_Pillow 62.8/150: 42% focus marking_targets, rapid_killing, trueshot
3:02.481 marked_shot Fluffy_Pillow 32.9/150: 22% focus marking_targets, rapid_killing, trueshot
3:03.454 sidewinders Fluffy_Pillow 18.0/150: 12% focus marking_targets, rapid_killing, trueshot
3:04.423 aimed_shot Fluffy_Pillow 83.0/150: 55% focus rapid_killing, trueshot
3:05.714 aimed_shot Fluffy_Pillow 50.7/150: 34% focus
3:07.524 arcane_torrent Fluffy_Pillow 20.7/150: 14% focus
3:07.524 Waiting 1.000 sec 35.7/150: 24% focus
3:08.524 marked_shot Fluffy_Pillow 46.8/150: 31% focus
3:09.881 Waiting 1.700 sec 31.8/150: 21% focus
3:11.581 aimed_shot Fluffy_Pillow 50.7/150: 34% focus
3:13.391 Waiting 3.600 sec 20.7/150: 14% focus
3:16.991 barrage Fluffy_Pillow 60.6/150: 40% focus
3:19.955 sidewinders Fluffy_Pillow 33.4/150: 22% focus
3:21.313 windburst Fluffy_Pillow 98.5/150: 66% focus marking_targets
3:22.671 aimed_shot Fluffy_Pillow 93.5/150: 62% focus marking_targets
3:24.481 aimed_shot Fluffy_Pillow 63.6/150: 42% focus marking_targets
3:26.292 sidewinders Fluffy_Pillow 33.6/150: 22% focus marking_targets
3:27.651 aimed_shot Fluffy_Pillow 98.7/150: 66% focus
3:29.460 aimed_shot Fluffy_Pillow 68.7/150: 46% focus
3:30.818 Waiting 0.500 sec 83.8/150: 56% focus raid_movement
3:31.318 marked_shot Fluffy_Pillow 89.3/150: 60% focus raid_movement
3:32.675 Waiting 4.100 sec 74.3/150: 50% focus raid_movement
3:36.775 barrage Fluffy_Pillow 119.8/150: 80% focus raid_movement
3:40.033 Waiting 0.600 sec 95.8/150: 64% focus
3:40.633 sidewinders Fluffy_Pillow 102.5/150: 68% focus marking_targets
3:41.992 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:43.802 windburst Fluffy_Pillow 100.1/150: 67% focus
3:45.159 aimed_shot Fluffy_Pillow 95.1/150: 63% focus
3:46.968 aimed_shot Fluffy_Pillow 65.1/150: 43% focus marking_targets
3:48.777 marked_shot Fluffy_Pillow 35.2/150: 23% focus marking_targets
3:50.134 sidewinders Fluffy_Pillow 20.2/150: 13% focus marking_targets
3:51.493 aimed_shot Fluffy_Pillow 85.3/150: 57% focus
3:53.304 aimed_shot Fluffy_Pillow 55.3/150: 37% focus
3:55.112 Waiting 0.500 sec 25.3/150: 17% focus
3:55.612 marked_shot Fluffy_Pillow 30.9/150: 21% focus
3:56.970 Waiting 2.200 sec 15.9/150: 11% focus
3:59.170 sidewinders Fluffy_Pillow 40.3/150: 27% focus marking_targets
4:00.527 barrage Fluffy_Pillow 105.3/150: 70% focus
4:03.506 Waiting 0.300 sec 78.3/150: 52% focus
4:03.806 aimed_shot Fluffy_Pillow 81.7/150: 54% focus lock_and_load(2)
4:05.165 windburst Fluffy_Pillow 96.7/150: 64% focus lock_and_load
4:06.524 aimed_shot Fluffy_Pillow 91.8/150: 61% focus lock_and_load
4:07.883 aimed_shot Fluffy_Pillow 106.8/150: 71% focus
4:09.693 Waiting 0.500 sec 76.9/150: 51% focus
4:10.193 marked_shot Fluffy_Pillow 82.4/150: 55% focus
4:11.551 aimed_shot Fluffy_Pillow 67.4/150: 45% focus
4:13.362 sidewinders Fluffy_Pillow 37.5/150: 25% focus
4:14.721 aimed_shot Fluffy_Pillow 102.6/150: 68% focus
4:16.529 aimed_shot Fluffy_Pillow 72.6/150: 48% focus
4:18.339 sidewinders Fluffy_Pillow 42.6/150: 28% focus marking_targets
4:19.696 aimed_shot Fluffy_Pillow 107.7/150: 72% focus
4:21.507 barrage Fluffy_Pillow 77.7/150: 52% focus
4:24.348 marked_shot Fluffy_Pillow 49.2/150: 33% focus
4:25.708 sidewinders Fluffy_Pillow 34.3/150: 23% focus marking_targets
4:27.066 windburst Fluffy_Pillow 99.3/150: 66% focus
4:28.425 aimed_shot Fluffy_Pillow 94.4/150: 63% focus
4:30.234 aimed_shot Fluffy_Pillow 64.4/150: 43% focus marking_targets
4:32.044 Waiting 1.400 sec 34.5/150: 23% focus marking_targets
4:33.444 marked_shot Fluffy_Pillow 50.0/150: 33% focus marking_targets
4:34.804 Waiting 0.800 sec 35.0/150: 23% focus marking_targets
4:35.604 sidewinders Fluffy_Pillow 43.9/150: 29% focus marking_targets
4:37.140 aimed_shot Fluffy_Pillow 110.9/150: 74% focus
4:38.950 arcane_torrent Fluffy_Pillow 81.0/150: 54% focus
4:38.950 aimed_shot Fluffy_Pillow 96.0/150: 64% focus
4:40.760 Waiting 0.100 sec 66.0/150: 44% focus
4:40.860 marked_shot Fluffy_Pillow 67.1/150: 45% focus
4:42.218 aimed_shot Fluffy_Pillow 52.2/150: 35% focus
4:44.028 Waiting 3.500 sec 22.2/150: 15% focus
4:47.528 barrage Fluffy_Pillow 61.0/150: 41% focus
4:50.525 windburst Fluffy_Pillow 34.2/150: 23% focus
4:51.884 Waiting 1.900 sec 29.2/150: 19% focus
4:53.784 aimed_shot Fluffy_Pillow 50.3/150: 34% focus
4:55.144 Waiting 1.100 sec 65.3/150: 44% focus raid_movement
4:56.244 sidewinders Fluffy_Pillow 77.5/150: 52% focus raid_movement, marking_targets
4:57.603 Waiting 2.100 sec 142.6/150: 95% focus raid_movement
4:59.703 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
5:01.062 Waiting 1.100 sec 135.1/150: 90% focus raid_movement, marking_targets
5:02.162 aimed_shot Fluffy_Pillow 147.2/150: 98% focus marking_targets
5:03.970 sidewinders Fluffy_Pillow 100.0/150: 67% focus marking_targets
5:05.327 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
5:07.137 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
5:08.495 Waiting 0.500 sec 150.0/150: 100% focus
5:08.995 marked_shot Fluffy_Pillow 150.0/150: 100% focus
5:10.354 barrage Fluffy_Pillow 135.1/150: 90% focus marking_targets
5:13.305 windburst Fluffy_Pillow 107.7/150: 72% focus marking_targets
5:14.663 aimed_shot Fluffy_Pillow 102.8/150: 69% focus lock_and_load(2), marking_targets
5:16.022 aimed_shot Fluffy_Pillow 117.8/150: 79% focus lock_and_load, marking_targets
5:17.379 aimed_shot Fluffy_Pillow 132.9/150: 89% focus marking_targets
5:19.189 sidewinders Fluffy_Pillow 100.1/150: 67% focus marking_targets
5:20.548 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
5:22.358 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
5:24.167 marked_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
5:25.524 aimed_shot Fluffy_Pillow 55.1/150: 37% focus marking_targets
5:27.332 sidewinders Fluffy_Pillow 25.2/150: 17% focus marking_targets
5:28.690 aimed_shot Fluffy_Pillow 90.2/150: 60% focus
5:30.499 barrage Fluffy_Pillow 60.2/150: 40% focus marking_targets
5:33.440 marked_shot Fluffy_Pillow 32.8/150: 22% focus bullseye(2), marking_targets
5:34.797 sidewinders Fluffy_Pillow 17.8/150: 12% focus bullseye(4), marking_targets
5:36.156 windburst Fluffy_Pillow 82.9/150: 55% focus bullseye(5)
5:37.515 aimed_shot Fluffy_Pillow 78.0/150: 52% focus bullseye(6), marking_targets
5:39.325 Waiting 0.200 sec 48.0/150: 32% focus bullseye(8), marking_targets
5:39.525 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(8), marking_targets
5:41.332 Waiting 0.500 sec 20.2/150: 13% focus bullseye(9), marking_targets
5:41.832 aimed_shot Fluffy_Pillow 25.8/150: 17% focus bullseye(11), lock_and_load(2), marking_targets
5:43.191 marked_shot Fluffy_Pillow 40.8/150: 27% focus bullseye(12), lock_and_load, marking_targets
5:44.548 aimed_shot Fluffy_Pillow 25.9/150: 17% focus bullseye(14), lock_and_load, marking_targets
5:45.907 sidewinders Fluffy_Pillow 40.9/150: 27% focus bullseye(15), marking_targets
5:47.266 aimed_shot Fluffy_Pillow 106.0/150: 71% focus bullseye(17), marking_targets
5:49.075 aimed_shot Fluffy_Pillow 76.0/150: 51% focus bullseye(17), marking_targets
5:50.881 Waiting 0.100 sec 46.0/150: 31% focus bullseye(19), marking_targets
5:50.981 marked_shot Fluffy_Pillow 47.1/150: 31% focus bullseye(19), marking_targets
5:52.338 sidewinders Fluffy_Pillow 32.2/150: 21% focus bullseye(21), marking_targets
5:53.696 potion Fluffy_Pillow 97.2/150: 65% focus bullseye(23), lock_and_load(2), marking_targets
5:53.696 barrage Fluffy_Pillow 97.2/150: 65% focus bullseye(23), lock_and_load(2), marking_targets, potion_of_deadly_grace
5:56.597 trueshot Fluffy_Pillow 69.3/150: 46% focus bullseye(30), lock_and_load(2), marking_targets, potion_of_deadly_grace
5:56.597 aimed_shot Fluffy_Pillow 69.3/150: 46% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:57.568 windburst Fluffy_Pillow 84.4/150: 56% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:58.539 aimed_shot Fluffy_Pillow 79.5/150: 53% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:59.510 aimed_shot Fluffy_Pillow 94.5/150: 63% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:00.482 aimed_shot Fluffy_Pillow 109.6/150: 73% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:01.777 aimed_shot Fluffy_Pillow 79.7/150: 53% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:03.070 marked_shot Fluffy_Pillow 49.7/150: 33% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:04.042 sidewinders Fluffy_Pillow 34.8/150: 23% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:05.014 aimed_shot Fluffy_Pillow 99.9/150: 67% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:06.307 aimed_shot Fluffy_Pillow 69.9/150: 47% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:07.599 marked_shot Fluffy_Pillow 40.0/150: 27% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:08.569 Waiting 0.200 sec 25.0/150: 17% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:08.769 arcane_torrent Fluffy_Pillow 28.1/150: 19% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:08.950 Waiting 0.300 sec 45.9/150: 31% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:09.250 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:10.543 Waiting 2.600 sec 20.6/150: 14% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:13.143 sidewinders Fluffy_Pillow 54.1/150: 36% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:14.708 barrage Fluffy_Pillow 121.4/150: 81% focus bullseye(30), potion_of_deadly_grace
6:17.684 Waiting 0.700 sec 94.4/150: 63% focus bullseye(30), potion_of_deadly_grace
6:18.384 windburst Fluffy_Pillow 102.2/150: 68% focus bullseye(30), potion_of_deadly_grace
6:19.893 aimed_shot Fluffy_Pillow 98.9/150: 66% focus bullseye(30), potion_of_deadly_grace
6:21.702 aimed_shot Fluffy_Pillow 68.9/150: 46% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:23.513 marked_shot Fluffy_Pillow 39.0/150: 26% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:24.873 sidewinders Fluffy_Pillow 24.0/150: 16% focus bullseye(30), marking_targets
6:26.232 aimed_shot Fluffy_Pillow 89.1/150: 59% focus bullseye(30), marking_targets
6:28.043 aimed_shot Fluffy_Pillow 59.1/150: 39% focus bullseye(30), marking_targets
6:29.850 Waiting 0.100 sec 29.2/150: 19% focus bullseye(30), marking_targets
6:29.950 marked_shot Fluffy_Pillow 30.3/150: 20% focus bullseye(30), marking_targets
6:31.307 Waiting 0.400 sec 15.3/150: 10% focus bullseye(30), marking_targets
6:31.707 sidewinders Fluffy_Pillow 19.7/150: 13% focus bullseye(30), marking_targets
6:33.279 aimed_shot Fluffy_Pillow 87.2/150: 58% focus bullseye(30)
6:35.088 aimed_shot Fluffy_Pillow 57.2/150: 38% focus bullseye(30)
6:36.897 Waiting 0.300 sec 27.2/150: 18% focus bullseye(30)
6:37.197 marked_shot Fluffy_Pillow 30.6/150: 20% focus bullseye(30)
6:38.556 Waiting 1.100 sec 15.6/150: 10% focus bullseye(30)
6:39.656 windburst Fluffy_Pillow 27.8/150: 19% focus bullseye(30), lock_and_load(2), marking_targets
6:41.248 aimed_shot Fluffy_Pillow 25.4/150: 17% focus bullseye(30), lock_and_load(2), marking_targets
6:42.604 aimed_shot Fluffy_Pillow 40.4/150: 27% focus bullseye(30), lock_and_load, marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 24197 22832 12714 (9030)
Stamina 29693 29693 18746
Intellect 6009 6009 0
Spirit 2 2 0
Health 1781580 1781580 0
Focus 150 150 0
Crit 26.82% 26.82% 3786
Haste 10.78% 10.78% 3502
Damage / Heal Versatility 2.74% 2.74% 1097
Attack Power 24197 22832 0
Mastery 22.43% 22.43% 9762
Armor 2482 2482 2482
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 844.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Nightborne's Jeweled Necklace
ilevel: 830, stats: { +908 Sta, +1217 Mastery, +487 Haste }
Local Shoulders Arcane Exterminator's Shoulderguards
ilevel: 830, stats: { 292 Armor, +807 AgiInt, +1211 Sta, +649 Crit, +259 Haste }
Local Chest Ley Dragoon's Hauberk
ilevel: 840, stats: { 401 Armor, +1182 AgiInt, +1773 Sta, +844 Mastery, +413 Haste }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Singular Chain Leggings
ilevel: 835, stats: { 345 Armor, +1692 Sta, +1128 AgiInt, +855 Mastery, +379 Haste }
Local Feet Frostburned Sabatons
ilevel: 860, stats: { 293 Armor, +1601 Sta, +1068 AgiInt, +617 Crit, +399 Haste }
Local Wrists Crestrider Conduit Bracers
ilevel: 850, stats: { 181 Armor, +729 AgiInt, +1094 Sta, +445 Haste, +288 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 850, stats: { 259 Armor, +1459 Sta, +973 AgiInt, +574 Crit, +406 Mastery }, gems: { +150 Mastery }
Local Finger1 Grasping Tentacle Loop
ilevel: 840, stats: { +997 Sta, +1011 Mastery, +758 Haste }, enchant: { +150 Mastery }
Local Finger2 Signet of the Highborne Magi
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Crit }, gems: { +150 Mastery }, enchant: { +150 Mastery }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 825, stats: { +977 Agi, +849 Mastery }
Local Trinket2 Silent Seashell
ilevel: 830, stats: { +1023 Agi, +865 Vers }
Local Back Herringbone Drape
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +475 Mastery, +232 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 868, weapon: { 8267 - 8269, 3 }, stats: { +1534 Agi, +2301 Sta, +710 Crit, +682 Mastery }, relics: { +42 ilevels, +36 ilevels, +40 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Dash
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=226/herbalism=232
talents=http://us.battle.net/wow/en/tool/talent-calculator#YZ!0002010
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:319:3:320:3:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=nightbornes_jeweled_necklace,id=134275,bonus_id=3397/1492/1675
shoulders=arcane_exterminators_shoulderguards,id=134472,bonus_id=1482
back=herringbone_drape,id=134246,bonus_id=3432/1502/3336,enchant=150agi
chest=ley_dragoons_hauberk,id=134302,bonus_id=3397/1502/3336
wrists=crestrider_conduit_bracers,id=134484,bonus_id=1727/1502/3336
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1807/1808/1472,gems=150mastery
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=singular_chain_leggings,id=139215,bonus_id=3379/1457
feet=frostburned_sabatons,id=141432,bonus_id=1472
finger1=grasping_tentacle_loop,id=133634,bonus_id=1727/1492/1813,enchant=150mastery
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1808/1492/1813,gems=150mastery,enchant=150mastery
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3396/605/1487/1675
trinket2=silent_seashell,id=134247,bonus_id=3397/607/1492/1675
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137365/136718/136720/0,relic_id=1727:1497:3336/1726:1477/1727:1492:1813/0

# Gear Summary
# gear_ilvl=843.87
# gear_agility=12714
# gear_stamina=18746
# gear_crit_rating=3786
# gear_haste_rating=3502
# gear_mastery_rating=9762
# gear_versatility_rating=1097
# gear_armor=2482
summon_pet=cat

Sarkul

Sarkul : 295504 dps

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
295503.6 295503.6 10675.2 / 3.613% 42982.6 / 14.5% 17694.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.7 16.7 Focus 20.96% 33.7 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Volley
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 707

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 295504
Aimed Shot 124755 (148590) 42.3% (50.4%) 118.3 3.37sec 497700 308461 Direct 118.2 294113 671710 418345 33.2%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.33 118.22 0.00 0.00 1.6135 0.0000 49458184.00 72708215.29 31.98 308461.32 308461.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.00 66.82% 294112.55 117104 310930 294137.26 290532 296585 23239037 34163585 31.98
crit 39.22 33.18% 671710.12 245918 994975 668758.37 646384 699179 26219147 38544630 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.15
 
    Legacy of the Windrunners 23835 8.1% 0.0 0.00sec 0 0 Direct 120.7 54321 125017 77284 33.3%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 120.67 0.00 0.00 0.0000 0.0000 9436336.16 13872308.00 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.44 66.67% 54321.43 21787 57847 54522.23 53312 55023 4384061 6444985 31.98
crit 40.22 33.33% 125017.28 45752 185112 125338.86 116807 134222 5052275 7427323 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 13164 (35759) 4.5% (12.1%) 158.0 2.51sec 89673 35866 Direct 158.0 25099 54331 32935 27.1%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 158.00 158.00 0.00 0.00 2.5002 0.0000 5214239.37 7665425.78 31.98 35865.99 35865.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.22 72.93% 25099.23 24825 26398 25086.23 25041 25123 2890657 4249540 31.98
crit 42.78 27.07% 54330.79 49650 79195 54336.89 53204 55870 2323582 3415886 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Volley 22595 7.7% 159.0 2.51sec 56315 0 Direct 158.0 42707 93507 57162 27.8%  

Stats details: volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.00 158.00 0.00 0.00 0.0000 0.0000 8954082.70 13163349.72 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.00 72.15% 42707.44 42058 45831 42715.49 42631 42828 4868832 7157644 31.98
crit 44.00 27.85% 93507.27 84116 137493 92746.32 89952 95868 4085251 6005706 31.98
 
 

Action details: volley

Static Values
  • id:194386
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:194386
  • name:Volley
  • school:physical
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
 
Deadly Grace 10617 3.6% 33.3 11.79sec 124827 0 Direct 33.3 80707 205776 125996 35.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.33 33.33 0.00 0.00 0.0000 0.0000 4160893.03 4160893.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.56 64.67% 80706.98 80707 80707 80706.98 80707 80707 1739684 1739684 0.00
crit 11.78 35.33% 205776.07 161414 242121 205400.67 185626 220110 2421209 2421209 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3682 1.2% 21.2 18.47sec 68688 0 Direct 21.2 50459 107072 67526 31.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.22 21.22 0.00 0.00 0.0000 0.0000 1457706.25 1457706.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.44 68.06% 50459.06 50459 50459 50459.06 50459 50459 728853 728853 0.00
crit 6.78 31.94% 107071.67 100918 151377 107390.35 100918 117738 728853 728853 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 44021 14.9% 35.3 11.43sec 491398 395569 Direct 35.3 327910 729852 486385 40.9%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.33 35.33 0.00 0.00 1.2423 0.0000 17362719.40 25524842.16 31.98 395569.21 395569.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.89 59.12% 327909.52 133736 355090 329827.51 311782 340655 6876518 10109134 31.98
crit 14.44 40.88% 729851.98 267471 1065270 724614.83 620718 793959 10486201 15415709 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=25}%.$?a190529[ Aimed Shot critical strike chance increased by {$s3=0}%.][] Lasts $6d. Stacks up to {$u=3} times.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 3934 1.3% 19.0 22.47sec 82565 0 Periodic 92.3 16977 0 16977 0.0% 5.9%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.00 0.00 93.00 92.33 0.0000 0.2500 1568743.33 1568743.33 0.00 67472.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.3 100.00% 16977.49 2650 16990 16990.00 16990 16990 1568743 1568743 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11395 3.8% 17.6 22.00sec 255511 0 Direct 17.2 193161 412663 258419 30.3%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.56 17.22 0.00 0.00 0.0000 0.0000 4485636.23 4485636.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.00 69.68% 193161.37 193161 193161 193161.37 193161 193161 2317936 2317936 0.00
crit 5.22 30.32% 412662.92 386323 579484 428736.48 386323 579484 2167700 2167700 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 13705 4.6% 41.0 9.71sec 132107 105986 Direct 41.0 100931 220047 133722 26.3%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.2465 0.0000 5416403.79 5416403.79 0.00 105985.79 105985.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.22 73.71% 100931.50 99252 108156 100939.63 100736 101231 3050070 3050070 0.00
crit 10.78 26.29% 220047.39 198504 324467 219196.65 202956 238073 2366334 2366334 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 23799 8.0% 17.6 22.22sec 532612 403796 Direct 18.6 391641 813426 506200 26.3%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.56 18.56 0.00 0.00 1.3191 0.0000 9350295.61 13745820.23 31.98 403795.80 403795.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 73.65% 391641.22 389049 413196 391521.93 389049 393879 5349201 7863833 31.98
crit 4.89 26.35% 813425.57 778098 1239587 812103.01 778098 905544 4001094 5881987 31.98
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.81sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.6 180.80sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.5sec 120.4sec 13.63% 48.07% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 44.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 122.4 0.0sec 0.6sec 18.53% 54.36% 93.4(93.4) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.10%
  • bullseye_2:0.14%
  • bullseye_3:0.17%
  • bullseye_4:0.18%
  • bullseye_5:0.04%
  • bullseye_6:0.18%
  • bullseye_7:0.18%
  • bullseye_8:0.11%
  • bullseye_9:0.17%
  • bullseye_10:0.12%
  • bullseye_11:0.24%
  • bullseye_12:0.12%
  • bullseye_13:0.30%
  • bullseye_14:0.23%
  • bullseye_15:0.12%
  • bullseye_16:0.26%
  • bullseye_17:0.11%
  • bullseye_18:0.21%
  • bullseye_19:0.15%
  • bullseye_20:0.09%
  • bullseye_21:0.17%
  • bullseye_22:0.23%
  • bullseye_23:0.08%
  • bullseye_24:0.14%
  • bullseye_25:0.28%
  • bullseye_26:0.08%
  • bullseye_27:0.25%
  • bullseye_28:0.13%
  • bullseye_29:0.05%
  • bullseye_30:13.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 12.0 0.4 30.0sec 28.6sec 7.36% 10.66% 0.4(0.6) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:3.97%
  • lock_and_load_2:3.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 34.0 11.0 12.0sec 8.9sec 35.49% 61.97% 11.0(11.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:35.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 338.5sec 0.0sec 14.87% 51.47% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 7.32% 38.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:7.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.6 0.0 205.4sec 190.2sec 9.60% 22.93% 0.0(0.0) 2.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.6 0.0 205.4sec 190.2sec 9.60% 32.21% 0.0(0.0) 2.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Volley

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_volley
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • volley_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194386
  • name:Volley
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 118.6 4700.0 39.6 39.7 12530.7
marked_shot Focus 34.9 1047.7 30.0 29.7 16572.3
volley Focus 158.7 476.1 3.0 3.0 18808.1
windburst Focus 18.7 373.8 20.0 21.3 25011.1
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.08 2009.80 (30.78%) 48.93 44.05 2.14%
focus_regen Focus 1448.62 4520.43 (69.22%) 3.12 216.67 4.57%
Resource RPS-Gain RPS-Loss
Focus 16.48 16.65
Combat End Resource Mean Min Max
Focus 98.97 47.94 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 2.8%

Procs

Count Interval
lock_and_load 12.4 28.6sec
no_vuln_aimed_shot 1.8 103.8sec
no_vuln_marked_shot 1.7 103.5sec
marking_targets 45.0 8.9sec
wasted_marking_targets 11.0 31.8sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Sarkul Damage Per Second
Count 9
Mean 295503.56
Minimum 279723.00
Maximum 326042.30
Spread ( max - min ) 46319.30
Range [ ( max - min ) / 2 * 100% ] 7.84%
Standard Deviation 16339.8243
5th Percentile 279723.00
95th Percentile 322705.56
( 95th Percentile - 5th Percentile ) 42982.55
Mean Distribution
Standard Deviation 5446.6081
95.00% Confidence Intervall ( 284828.41 - 306178.72 )
Normalized 95.00% Confidence Intervall ( 96.39% - 103.61% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11745
0.1 Scale Factor Error with Delta=300 2279179
0.05 Scale Factor Error with Delta=300 9116716
0.01 Scale Factor Error with Delta=300 227917900
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9
Mean 295503.56
Minimum 279723.00
Maximum 326042.30
Spread ( max - min ) 46319.30
Range [ ( max - min ) / 2 * 100% ] 7.84%
Standard Deviation 16339.8243
5th Percentile 279723.00
95th Percentile 322705.56
( 95th Percentile - 5th Percentile ) 42982.55
Mean Distribution
Standard Deviation 5446.6081
95.00% Confidence Intervall ( 284828.41 - 306178.72 )
Normalized 95.00% Confidence Intervall ( 96.39% - 103.61% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11745
0.1 Scale Factor Error with Delta=300 2279179
0.05 Scale Factor Error with Delta=300 9116716
0.01 Scale Factor Error with Delta=300 227917900
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9
Mean 295503.56
Minimum 279723.00
Maximum 326042.30
Spread ( max - min ) 46319.30
Range [ ( max - min ) / 2 * 100% ] 7.84%
Damage
Sample Data Sarkul Damage
Count 9
Mean 116865239.88
Minimum 93488463.03
Maximum 141913378.95
Spread ( max - min ) 48424915.92
Range [ ( max - min ) / 2 * 100% ] 20.72%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 volley
7 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
9 3.85 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
0.00 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
0.00 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 17.69 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 11.38 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 64.46 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 45.08 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 28.00 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 2.62 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 24.92 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 1.31 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.69 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.69 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.54 marked_shot
R 0.62 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
0.00 barrage
S 8.31 aimed_shot,if=execute_time<debuff.vulnerability.remains
T 2.23 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
U 0.77 marked_shot
0.00 windburst
V 1.23 aimed_shot,if=execute_time<debuff.vulnerability.remains
W 0.85 sidewinders
X 0.15 aimed_shot
0.00 arcane_shot

Sample Sequence

0456789OSSPQRRSSSPQSSTQSPGGGGDGJKGGIHFHKGGIDHHHFGGIFHHDKGGIKGGIKGGDGIKGGIKGGDG9IKGIKGGDGJKGGIKGGIDKGGIHKGGINDFGGIHFGGIHDKGIKIHHDHHHFGGGIH9HFGGDGGJKGGIKGIHDHFHKGGIHDHFKGGIHHDHHHKGGIHHHFHHDKGGIHMFHHDHKG9NGIFGIHFGGDGJKGGIKGIHDWV

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
Pre volley Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 aimed_shot Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:01.292 aimed_shot Fluffy_Pillow 99.6/150: 66% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.288 sidewinders Fluffy_Pillow 69.7/150: 46% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.041 marked_shot Fluffy_Pillow 131.9/150: 88% focus bloodlust, blood_fury, lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.796 aimed_shot Fluffy_Pillow 117.1/150: 78% focus bloodlust, blood_fury, lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.548 aimed_shot Fluffy_Pillow 129.3/150: 86% focus bloodlust, blood_fury, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.303 aimed_shot Fluffy_Pillow 144.5/150: 96% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.298 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.293 aimed_shot Fluffy_Pillow 67.2/150: 45% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.288 sidewinders Fluffy_Pillow 37.2/150: 25% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.044 marked_shot Fluffy_Pillow 99.5/150: 66% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:09.798 aimed_shot Fluffy_Pillow 84.7/150: 56% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.793 aimed_shot Fluffy_Pillow 51.8/150: 35% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:11.787 sidewinders Fluffy_Pillow 18.8/150: 13% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:12.541 marked_shot Fluffy_Pillow 84.1/150: 56% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:13.295 aimed_shot Fluffy_Pillow 66.3/150: 44% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:14.291 sidewinders Fluffy_Pillow 36.4/150: 24% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:15.047 aimed_shot Fluffy_Pillow 98.3/150: 66% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.439 aimed_shot Fluffy_Pillow 115.4/150: 77% focus bloodlust, lock_and_load, marking_targets, potion_of_deadly_grace
0:17.483 aimed_shot Fluffy_Pillow 130.5/150: 87% focus bloodlust, marking_targets, potion_of_deadly_grace
0:18.876 aimed_shot Fluffy_Pillow 97.5/150: 65% focus bloodlust, marking_targets, potion_of_deadly_grace
0:20.268 windburst Fluffy_Pillow 64.6/150: 43% focus bloodlust, marking_targets, potion_of_deadly_grace
0:21.311 aimed_shot Fluffy_Pillow 59.6/150: 40% focus bloodlust, marking_targets, potion_of_deadly_grace
0:22.704 Waiting 0.300 sec 26.7/150: 18% focus bloodlust, marking_targets, potion_of_deadly_grace
0:23.004 marked_shot Fluffy_Pillow 31.0/150: 21% focus bloodlust, marking_targets, potion_of_deadly_grace
0:24.048 sidewinders Fluffy_Pillow 16.1/150: 11% focus bloodlust, marking_targets, potion_of_deadly_grace
0:25.092 aimed_shot Fluffy_Pillow 78.1/150: 52% focus bloodlust, potion_of_deadly_grace
0:26.483 Waiting 0.400 sec 45.2/150: 30% focus bloodlust, potion_of_deadly_grace
0:26.883 aimed_shot Fluffy_Pillow 50.9/150: 34% focus bloodlust, potion_of_deadly_grace
0:28.273 Waiting 0.900 sec 21.0/150: 14% focus bloodlust
0:29.173 marked_shot Fluffy_Pillow 30.9/150: 21% focus bloodlust
0:30.217 Waiting 2.800 sec 16.0/150: 11% focus bloodlust
0:33.017 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bloodlust
0:34.409 sidewinders Fluffy_Pillow 20.4/150: 14% focus bloodlust
0:35.454 aimed_shot Fluffy_Pillow 82.5/150: 55% focus bloodlust
0:36.845 sidewinders Fluffy_Pillow 49.5/150: 33% focus bloodlust, marking_targets
0:37.889 aimed_shot Fluffy_Pillow 114.6/150: 76% focus bloodlust
0:39.280 aimed_shot Fluffy_Pillow 81.6/150: 54% focus bloodlust
0:40.324 Waiting 1.600 sec 96.7/150: 64% focus bloodlust, raid_movement
0:41.924 marked_shot Fluffy_Pillow 113.4/150: 76% focus raid_movement
0:43.281 Waiting 3.900 sec 98.4/150: 66% focus raid_movement
0:47.181 windburst Fluffy_Pillow 138.7/150: 92% focus marking_targets
0:48.536 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets
0:50.342 aimed_shot Fluffy_Pillow 97.1/150: 65% focus marking_targets
0:52.149 aimed_shot Fluffy_Pillow 67.1/150: 45% focus marking_targets
0:53.957 sidewinders Fluffy_Pillow 34.1/150: 23% focus marking_targets
0:55.314 aimed_shot Fluffy_Pillow 96.2/150: 64% focus
0:57.122 aimed_shot Fluffy_Pillow 66.2/150: 44% focus
0:58.931 Waiting 0.100 sec 33.3/150: 22% focus
0:59.031 marked_shot Fluffy_Pillow 34.4/150: 23% focus
1:00.388 Waiting 3.500 sec 19.4/150: 13% focus
1:03.888 sidewinders Fluffy_Pillow 52.2/150: 35% focus
1:05.243 aimed_shot Fluffy_Pillow 117.3/150: 78% focus
1:07.053 aimed_shot Fluffy_Pillow 84.3/150: 56% focus marking_targets
1:08.862 windburst Fluffy_Pillow 51.4/150: 34% focus marking_targets
1:10.219 sidewinders Fluffy_Pillow 46.4/150: 31% focus marking_targets
1:11.576 aimed_shot Fluffy_Pillow 108.5/150: 72% focus
1:13.385 aimed_shot Fluffy_Pillow 78.5/150: 52% focus
1:15.193 Waiting 0.100 sec 45.6/150: 30% focus
1:15.293 marked_shot Fluffy_Pillow 46.7/150: 31% focus
1:16.649 Waiting 0.300 sec 31.7/150: 21% focus
1:16.949 sidewinders Fluffy_Pillow 32.0/150: 21% focus marking_targets
1:18.303 aimed_shot Fluffy_Pillow 97.1/150: 65% focus
1:20.110 aimed_shot Fluffy_Pillow 64.1/150: 43% focus marking_targets
1:21.918 Waiting 0.100 sec 34.1/150: 23% focus marking_targets
1:22.018 marked_shot Fluffy_Pillow 35.2/150: 23% focus marking_targets
1:23.374 Waiting 3.000 sec 17.3/150: 12% focus marking_targets
1:26.374 sidewinders Fluffy_Pillow 47.5/150: 32% focus marking_targets
1:27.962 aimed_shot Fluffy_Pillow 112.1/150: 75% focus
1:29.768 aimed_shot Fluffy_Pillow 82.2/150: 55% focus
1:31.574 windburst Fluffy_Pillow 49.2/150: 33% focus
1:32.930 Waiting 0.800 sec 44.2/150: 29% focus
1:33.730 aimed_shot Fluffy_Pillow 50.1/150: 33% focus
1:35.536 Waiting 2.100 sec 20.1/150: 13% focus
1:37.636 marked_shot Fluffy_Pillow 40.4/150: 27% focus
1:38.993 Waiting 2.300 sec 22.4/150: 15% focus
1:41.293 sidewinders Fluffy_Pillow 44.9/150: 30% focus marking_targets
1:42.649 aimed_shot Fluffy_Pillow 110.0/150: 73% focus
1:44.456 aimed_shot Fluffy_Pillow 77.0/150: 51% focus
1:46.264 Waiting 0.100 sec 47.1/150: 31% focus
1:46.364 marked_shot Fluffy_Pillow 48.2/150: 32% focus
1:47.720 Waiting 1.700 sec 30.2/150: 20% focus
1:49.420 sidewinders Fluffy_Pillow 46.0/150: 31% focus marking_targets
1:50.776 aimed_shot Fluffy_Pillow 111.1/150: 74% focus
1:52.583 aimed_shot Fluffy_Pillow 78.1/150: 52% focus
1:54.392 windburst Fluffy_Pillow 48.2/150: 32% focus
1:55.749 Waiting 0.900 sec 40.2/150: 27% focus
1:56.649 aimed_shot Fluffy_Pillow 50.2/150: 33% focus
1:58.458 Waiting 1.300 sec 17.2/150: 11% focus
1:59.758 blood_fury Fluffy_Pillow 31.7/150: 21% focus
2:00.000 Waiting 0.500 sec 34.3/150: 23% focus blood_fury
2:00.500 marked_shot Fluffy_Pillow 36.9/150: 25% focus blood_fury, marking_targets
2:01.858 sidewinders Fluffy_Pillow 21.9/150: 15% focus blood_fury, marking_targets
2:03.214 aimed_shot Fluffy_Pillow 84.0/150: 56% focus blood_fury
2:05.003 Waiting 1.900 sec 103.8/150: 69% focus blood_fury, raid_movement
2:06.903 marked_shot Fluffy_Pillow 121.9/150: 81% focus blood_fury, raid_movement
2:08.259 Waiting 3.900 sec 106.9/150: 71% focus blood_fury, raid_movement
2:12.159 sidewinders Fluffy_Pillow 144.1/150: 96% focus blood_fury, marking_targets
2:13.516 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury
2:15.324 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:17.133 windburst Fluffy_Pillow 67.1/150: 45% focus marking_targets
2:18.491 aimed_shot Fluffy_Pillow 62.2/150: 41% focus marking_targets
2:20.296 Waiting 2.600 sec 29.2/150: 19% focus marking_targets
2:22.896 marked_shot Fluffy_Pillow 55.0/150: 37% focus marking_targets
2:24.253 sidewinders Fluffy_Pillow 40.0/150: 27% focus marking_targets
2:25.609 aimed_shot Fluffy_Pillow 102.1/150: 68% focus
2:27.418 aimed_shot Fluffy_Pillow 69.1/150: 46% focus
2:29.225 Waiting 0.100 sec 39.2/150: 26% focus
2:29.325 marked_shot Fluffy_Pillow 40.3/150: 27% focus
2:30.683 Waiting 2.000 sec 22.3/150: 15% focus
2:32.683 sidewinders Fluffy_Pillow 41.5/150: 28% focus marking_targets
2:34.040 aimed_shot Fluffy_Pillow 106.6/150: 71% focus
2:35.851 aimed_shot Fluffy_Pillow 73.6/150: 49% focus marking_targets
2:37.659 Waiting 0.100 sec 43.7/150: 29% focus marking_targets
2:37.759 marked_shot Fluffy_Pillow 44.8/150: 30% focus marking_targets
2:39.115 windburst Fluffy_Pillow 26.8/150: 18% focus marking_targets
2:40.472 Waiting 1.700 sec 21.9/150: 15% focus marking_targets
2:42.172 sidewinders Fluffy_Pillow 37.7/150: 25% focus marking_targets
2:43.720 aimed_shot Fluffy_Pillow 101.9/150: 68% focus
2:45.527 aimed_shot Fluffy_Pillow 71.9/150: 48% focus
2:47.334 Waiting 0.100 sec 38.9/150: 26% focus
2:47.434 marked_shot Fluffy_Pillow 40.1/150: 27% focus
2:48.789 Waiting 2.600 sec 25.1/150: 17% focus
2:51.389 aimed_shot Fluffy_Pillow 50.9/150: 34% focus
2:53.197 sidewinders Fluffy_Pillow 17.9/150: 12% focus marking_targets
2:54.554 aimed_shot Fluffy_Pillow 80.0/150: 53% focus
2:56.360 aimed_shot Fluffy_Pillow 50.0/150: 33% focus
2:58.167 Waiting 1.200 sec 17.0/150: 11% focus
2:59.367 marked_shot Fluffy_Pillow 30.4/150: 20% focus
3:00.723 trueshot Fluffy_Pillow 12.4/150: 8% focus marking_targets
3:00.723 Waiting 0.500 sec 12.4/150: 8% focus marking_targets, rapid_killing, trueshot
3:01.223 windburst Fluffy_Pillow 20.1/150: 13% focus marking_targets, rapid_killing, trueshot
3:02.193 Waiting 1.600 sec 15.2/150: 10% focus marking_targets, rapid_killing, trueshot
3:03.793 sidewinders Fluffy_Pillow 37.0/150: 25% focus marking_targets, rapid_killing, trueshot
3:04.983 aimed_shot Fluffy_Pillow 102.5/150: 68% focus rapid_killing, trueshot
3:06.275 aimed_shot Fluffy_Pillow 72.6/150: 48% focus rapid_killing, trueshot
3:07.567 marked_shot Fluffy_Pillow 39.6/150: 26% focus rapid_killing, trueshot
3:08.538 Waiting 2.100 sec 21.7/150: 14% focus rapid_killing, trueshot
3:10.638 aimed_shot Fluffy_Pillow 51.3/150: 34% focus rapid_killing, trueshot
3:11.930 Waiting 2.700 sec 21.3/150: 14% focus rapid_killing, trueshot
3:14.630 sidewinders Fluffy_Pillow 57.2/150: 38% focus marking_targets, rapid_killing, trueshot
3:15.806 aimed_shot Fluffy_Pillow 125.1/150: 83% focus
3:17.614 aimed_shot Fluffy_Pillow 92.2/150: 61% focus
3:19.422 Waiting 0.500 sec 59.2/150: 39% focus
3:19.922 marked_shot Fluffy_Pillow 64.8/150: 43% focus
3:21.279 Waiting 0.300 sec 49.8/150: 33% focus
3:21.579 aimed_shot Fluffy_Pillow 50.1/150: 33% focus
3:23.387 windburst Fluffy_Pillow 20.2/150: 13% focus
3:24.743 sidewinders Fluffy_Pillow 12.2/150: 8% focus marking_targets
3:26.099 aimed_shot Fluffy_Pillow 77.2/150: 51% focus
3:27.906 Waiting 1.900 sec 44.3/150: 30% focus marking_targets
3:29.806 marked_shot Fluffy_Pillow 62.3/150: 42% focus marking_targets
3:31.163 sidewinders Fluffy_Pillow 47.4/150: 32% focus raid_movement, marking_targets
3:32.519 Waiting 3.700 sec 109.4/150: 73% focus raid_movement
3:36.219 marked_shot Fluffy_Pillow 147.4/150: 98% focus raid_movement, marking_targets
3:37.576 aimed_shot Fluffy_Pillow 132.5/150: 88% focus marking_targets
3:39.384 aimed_shot Fluffy_Pillow 99.5/150: 66% focus marking_targets
3:41.192 Waiting 3.300 sec 116.6/150: 78% focus lock_and_load, marking_targets
3:44.492 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:46.096 aimed_shot Fluffy_Pillow 130.1/150: 87% focus lock_and_load, marking_targets
3:47.453 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
3:49.260 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
3:51.069 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:52.427 aimed_shot Fluffy_Pillow 132.2/150: 88% focus lock_and_load(2)
3:53.784 aimed_shot Fluffy_Pillow 147.2/150: 98% focus lock_and_load
3:55.139 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:56.947 marked_shot Fluffy_Pillow 100.1/150: 67% focus
3:58.305 aimed_shot Fluffy_Pillow 85.1/150: 57% focus
4:00.113 blood_fury Fluffy_Pillow 52.2/150: 35% focus marking_targets
4:00.113 aimed_shot Fluffy_Pillow 52.2/150: 35% focus blood_fury, marking_targets
4:01.919 sidewinders Fluffy_Pillow 22.2/150: 15% focus blood_fury, marking_targets
4:03.276 aimed_shot Fluffy_Pillow 84.2/150: 56% focus blood_fury, marking_targets
4:05.087 aimed_shot Fluffy_Pillow 51.3/150: 34% focus blood_fury, marking_targets
4:06.895 windburst Fluffy_Pillow 21.3/150: 14% focus blood_fury, marking_targets
4:08.251 aimed_shot Fluffy_Pillow 13.4/150: 9% focus blood_fury, lock_and_load(2), marking_targets
4:09.606 aimed_shot Fluffy_Pillow 28.4/150: 19% focus blood_fury, lock_and_load, marking_targets
4:10.961 marked_shot Fluffy_Pillow 40.4/150: 27% focus blood_fury, marking_targets
4:12.318 sidewinders Fluffy_Pillow 25.5/150: 17% focus blood_fury, marking_targets
4:13.673 aimed_shot Fluffy_Pillow 87.5/150: 58% focus blood_fury
4:15.481 aimed_shot Fluffy_Pillow 54.5/150: 36% focus marking_targets
4:17.289 Waiting 0.500 sec 24.6/150: 16% focus marking_targets
4:17.789 marked_shot Fluffy_Pillow 30.1/150: 20% focus marking_targets
4:19.147 sidewinders Fluffy_Pillow 12.2/150: 8% focus marking_targets
4:20.503 aimed_shot Fluffy_Pillow 77.2/150: 51% focus
4:22.310 Waiting 1.900 sec 44.2/150: 29% focus
4:24.210 marked_shot Fluffy_Pillow 62.3/150: 42% focus
4:25.567 Waiting 0.300 sec 47.4/150: 32% focus
4:25.867 aimed_shot Fluffy_Pillow 50.7/150: 34% focus
4:27.676 Waiting 0.400 sec 17.7/150: 12% focus
4:28.076 windburst Fluffy_Pillow 22.2/150: 15% focus
4:29.603 Waiting 3.400 sec 16.1/150: 11% focus
4:33.003 aimed_shot Fluffy_Pillow 50.8/150: 34% focus
4:34.810 sidewinders Fluffy_Pillow 17.8/150: 12% focus
4:36.167 aimed_shot Fluffy_Pillow 82.9/150: 55% focus
4:37.973 sidewinders Fluffy_Pillow 49.9/150: 33% focus marking_targets
4:39.330 aimed_shot Fluffy_Pillow 114.9/150: 77% focus
4:41.137 aimed_shot Fluffy_Pillow 82.0/150: 55% focus
4:42.945 Waiting 0.100 sec 49.0/150: 33% focus
4:43.045 marked_shot Fluffy_Pillow 50.1/150: 33% focus
4:44.402 Waiting 1.700 sec 35.2/150: 23% focus
4:46.102 aimed_shot Fluffy_Pillow 51.0/150: 34% focus
4:47.909 Waiting 1.500 sec 21.1/150: 14% focus
4:49.409 windburst Fluffy_Pillow 34.7/150: 23% focus
4:50.956 Waiting 2.000 sec 28.8/150: 19% focus
4:52.956 aimed_shot Fluffy_Pillow 51.0/150: 34% focus
4:54.763 Waiting 1.100 sec 18.0/150: 12% focus
4:55.863 sidewinders Fluffy_Pillow 30.2/150: 20% focus raid_movement
4:57.219 Waiting 2.700 sec 92.3/150: 62% focus raid_movement, marking_targets
4:59.919 sidewinders Fluffy_Pillow 119.2/150: 79% focus raid_movement, marking_targets
5:01.275 Waiting 0.900 sec 150.0/150: 100% focus raid_movement
5:02.175 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
5:03.984 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
5:05.793 marked_shot Fluffy_Pillow 117.1/150: 78% focus lock_and_load, marking_targets
5:07.148 aimed_shot Fluffy_Pillow 99.1/150: 66% focus lock_and_load, marking_targets
5:08.504 aimed_shot Fluffy_Pillow 114.2/150: 76% focus marking_targets
5:10.311 Waiting 0.400 sec 81.2/150: 54% focus marking_targets
5:10.711 windburst Fluffy_Pillow 85.6/150: 57% focus marking_targets
5:12.309 aimed_shot Fluffy_Pillow 80.4/150: 54% focus marking_targets
5:14.116 aimed_shot Fluffy_Pillow 50.4/150: 34% focus marking_targets
5:15.924 aimed_shot Fluffy_Pillow 67.4/150: 45% focus lock_and_load, marking_targets
5:17.279 sidewinders Fluffy_Pillow 82.5/150: 55% focus marking_targets
5:18.635 aimed_shot Fluffy_Pillow 144.5/150: 96% focus
5:20.442 aimed_shot Fluffy_Pillow 97.6/150: 65% focus
5:22.249 Waiting 0.100 sec 67.6/150: 45% focus
5:22.349 marked_shot Fluffy_Pillow 68.7/150: 46% focus
5:23.705 aimed_shot Fluffy_Pillow 50.8/150: 34% focus lock_and_load(2)
5:25.062 aimed_shot Fluffy_Pillow 65.8/150: 44% focus lock_and_load
5:26.418 aimed_shot Fluffy_Pillow 77.8/150: 52% focus
5:28.225 Waiting 0.100 sec 47.9/150: 32% focus
5:28.325 sidewinders Fluffy_Pillow 49.0/150: 33% focus
5:29.682 aimed_shot Fluffy_Pillow 111.0/150: 74% focus
5:31.489 aimed_shot Fluffy_Pillow 78.1/150: 52% focus marking_targets
5:33.296 windburst Fluffy_Pillow 48.1/150: 32% focus marking_targets
5:34.652 sidewinders Fluffy_Pillow 40.1/150: 27% focus bullseye(9), marking_targets
5:36.008 aimed_shot Fluffy_Pillow 105.2/150: 70% focus bullseye(11)
5:37.815 aimed_shot Fluffy_Pillow 72.2/150: 48% focus bullseye(13)
5:39.622 Waiting 0.100 sec 39.2/150: 26% focus bullseye(16)
5:39.722 marked_shot Fluffy_Pillow 40.3/150: 27% focus bullseye(16)
5:41.078 Waiting 2.500 sec 25.4/150: 17% focus bullseye(18)
5:43.578 aimed_shot Fluffy_Pillow 50.1/150: 33% focus bullseye(20)
5:45.385 Waiting 0.900 sec 17.1/150: 11% focus bullseye(22)
5:46.285 potion Fluffy_Pillow 27.1/150: 18% focus bullseye(23)
5:46.285 Waiting 3.700 sec 27.1/150: 18% focus bullseye(23), potion_of_deadly_grace
5:49.985 sidewinders Fluffy_Pillow 65.1/150: 43% focus bullseye(25), potion_of_deadly_grace
5:51.342 aimed_shot Fluffy_Pillow 127.2/150: 85% focus bullseye(28), potion_of_deadly_grace
5:53.149 aimed_shot Fluffy_Pillow 94.2/150: 63% focus bullseye(30), marking_targets, potion_of_deadly_grace
5:54.956 windburst Fluffy_Pillow 64.2/150: 43% focus bullseye(30), marking_targets, potion_of_deadly_grace
5:56.314 aimed_shot Fluffy_Pillow 56.3/150: 38% focus bullseye(30), marking_targets, potion_of_deadly_grace
5:58.121 sidewinders Fluffy_Pillow 26.3/150: 18% focus bullseye(30), marking_targets, potion_of_deadly_grace
5:59.477 aimed_shot Fluffy_Pillow 88.4/150: 59% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:01.286 blood_fury Fluffy_Pillow 55.4/150: 37% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:01.286 trueshot Fluffy_Pillow 55.4/150: 37% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:01.286 aimed_shot Fluffy_Pillow 55.4/150: 37% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:02.576 Waiting 0.300 sec 25.4/150: 17% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:02.876 marked_shot Fluffy_Pillow 30.1/150: 20% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:03.845 sidewinders Fluffy_Pillow 12.1/150: 8% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:04.814 aimed_shot Fluffy_Pillow 77.2/150: 51% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:06.107 marked_shot Fluffy_Pillow 44.2/150: 29% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:07.079 Waiting 1.600 sec 29.3/150: 20% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:08.679 aimed_shot Fluffy_Pillow 51.2/150: 34% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:09.969 Waiting 2.500 sec 18.2/150: 12% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:12.469 sidewinders Fluffy_Pillow 54.0/150: 36% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:13.612 aimed_shot Fluffy_Pillow 118.7/150: 79% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:14.904 aimed_shot Fluffy_Pillow 88.8/150: 59% focus blood_fury, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:16.196 windburst Fluffy_Pillow 55.8/150: 37% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:17.664 Waiting 0.100 sec 49.5/150: 33% focus bullseye(30), marking_targets
6:17.764 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bullseye(30), marking_targets
6:19.573 Waiting 2.400 sec 20.7/150: 14% focus bullseye(30), marking_targets
6:21.973 marked_shot Fluffy_Pillow 44.3/150: 30% focus bullseye(30), marking_targets
6:23.330 sidewinders Fluffy_Pillow 26.3/150: 18% focus bullseye(30), marking_targets
6:24.687 aimed_shot Fluffy_Pillow 91.4/150: 61% focus bullseye(30)
6:26.495 aimed_shot Fluffy_Pillow 58.4/150: 39% focus bullseye(30), marking_targets
6:28.303 Waiting 0.500 sec 25.5/150: 17% focus bullseye(30), marking_targets
6:28.803 marked_shot Fluffy_Pillow 31.0/150: 21% focus bullseye(30), marking_targets
6:30.160 sidewinders Fluffy_Pillow 16.1/150: 11% focus bullseye(30), marking_targets
6:31.517 aimed_shot Fluffy_Pillow 78.1/150: 52% focus bullseye(30)
6:33.325 Waiting 1.900 sec 48.1/150: 32% focus bullseye(30)
6:35.225 marked_shot Fluffy_Pillow 66.2/150: 44% focus bullseye(30)
6:36.581 Waiting 0.200 sec 48.2/150: 32% focus bullseye(30)
6:36.781 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye(30)
6:38.589 windburst Fluffy_Pillow 20.5/150: 14% focus bullseye(30)
6:39.946 sidewinders Fluffy_Pillow 12.6/150: 8% focus bullseye(30)
6:41.302 aimed_shot Fluffy_Pillow 77.6/150: 52% focus bullseye(30)
6:43.109 Waiting 0.400 sec 44.6/150: 30% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 24663 23298 13162 (8757)
Stamina 33391 33391 21166
Intellect 6003 6003 0
Spirit 2 2 0
Health 2003460 2003460 0
Focus 150 150 0
Crit 22.35% 22.35% 2574
Haste 10.87% 10.87% 3532
Damage / Heal Versatility 1.94% 1.94% 775
Attack Power 24663 23298 0
Mastery 26.39% 26.39% 11980
Armor 2585 2585 2585
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 858.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Matted Fur Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +574 Crit, +406 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Whelp Handler's Lined Boots
ilevel: 845, stats: { 280 Armor, +929 AgiInt, +1393 Sta, +604 Mastery, +357 Haste }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 855, stats: { +1147 Sta, +1230 Mastery, +641 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Mana Crystal Shard
ilevel: 840, stats: { +1123 Agi, +898 Mastery }
Local Back Cape of Valarjar Courage
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +366 Mastery, +366 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 876, weapon: { 8908 - 8909, 3 }, stats: { +1653 Agi, +2480 Sta, +732 Crit, +702 Mastery }, relics: { +43 ilevels, +40 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Dash
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=707/leatherworking=800
talents=http://us.battle.net/wow/en/tool/talent-calculator#YZ!0002020
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/volley
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=matted_fur_pauldrons,id=139217,bonus_id=1807/1472
back=cape_of_valarjar_courage,id=133765,bonus_id=3412/1502/1813,enchant=150agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=whelp_handlers_lined_boots,id=134464,bonus_id=3411/1497/1813
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3432/1517/3337,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=mana_crystal_shard,id=134335,bonus_id=3432/605/1502/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/137302/136973/0,relic_id=1807:1472/1727:1492:1813/1727:1502:3336/0

# Gear Summary
# gear_ilvl=858.07
# gear_agility=13162
# gear_stamina=21166
# gear_crit_rating=2574
# gear_haste_rating=3532
# gear_mastery_rating=11980
# gear_versatility_rating=775
# gear_armor=2585
summon_pet=cat

Zipi

Zipi : 280923 dps

  • Race: Tauren
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
280923.0 280923.0 4421.3 / 1.574% 14819.3 / 5.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 6.49% 53.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Zipi/advanced
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: The Fires of Justice (Retribution Paladin)
  • 45: Fist of Justice
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 317
  • herbalism: 363

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zipi 280923
Blade of Wrath 31554 11.2% 67.0 5.79sec 186609 172608 Direct 67.0 83324 171137 105004 25.5%  
Periodic 181.6 24017 48594 30189 24.7% 90.6%

Stats details: blade_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.00 67.00 181.56 181.56 1.0811 1.9783 12502824.65 12502824.65 0.00 28968.01 172607.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.89 74.46% 83324.45 71828 109538 83388.24 81967 86295 4159968 4159968 0.00
crit 17.11 25.54% 171137.00 146529 223457 169570.68 157519 176617 2908447 2908447 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.8 75.34% 24017.01 75 32759 23960.88 23656 24244 3276563 3276563 0.00
crit 44.8 24.66% 48593.60 2257 66828 48234.65 46262 49804 2157846 2157846 0.00
 
 

Action details: blade_of_wrath

Static Values
  • id:202270
  • school:holy
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:202270
  • name:Blade of Wrath
  • school:holy
  • tooltip:Deals {$s4=0} Holy damage every $t4 sec.
  • description:Strikes an enemy with the Blade of Wrath, dealing $sw2 Holy damage, and an additional $o4 Holy damage over {$d=6 seconds}. |cFFFFFFFFGenerates {$s3=2} Holy Power.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.36
 
Greater Blessing of Might (blessing_of_might_proc) 21582 7.6% 185.6 2.41sec 45842 0 Direct 151.7 55459 0 55459 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.56 151.67 0.00 0.00 0.0000 0.0000 8506200.56 8506200.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 151.67 100.00% 55458.80 8683 546935 56334.59 50223 68190 8506201 8506201 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20192.22
  • base_dd_max:20192.22
 
Crusader Strike 34402 12.3% 110.4 3.56sec 123524 113972 Direct 110.4 87081 176216 125291 41.6%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.44 110.44 0.00 0.00 1.0838 0.0000 13642559.58 20055854.85 31.98 113971.98 113971.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.44 58.35% 87081.04 74273 113267 86465.77 83612 88220 5575607 8196671 31.98
crit 46.00 41.65% 176216.40 151517 231064 175568.41 168998 181442 8066952 11859184 31.98
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4&!talent.the_fires_of_justice.enabled
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for $sw2 Physical damage. Maximum 2 charges.{$?s85256=true}[ |cFFFFFFFFGenerates {$s3=1} Holy Power.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Judgment 24751 8.8% 42.1 9.34sec 232876 210774 Direct 42.1 180449 373327 232861 27.7%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.11 42.11 0.00 0.00 1.1049 0.0000 9806659.70 9806659.70 0.00 210773.52 210773.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.44 72.30% 180448.75 159777 243660 180264.87 176797 183903 5493136 5493136 0.00
crit 11.67 27.70% 373326.84 325945 497067 369622.61 349799 388690 4313523 4313523 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to {$s3=3} other nearby enemies]?s137027[ and {$s2=1} other nearby enemy][], dealing {$s1=1} Holy damage{$?s76672=false}[, and causing them to take $197277s2% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s137029[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?s137028[, and reducing the remaining cooldown on Shield of the Righteous by {$s2=1} sec, or ${$m2*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 14849 5.3% 141.4 2.78sec 41675 16330 Direct 141.4 33847 68711 41703 22.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.44 141.44 0.00 0.00 2.5520 0.0000 5894722.19 8665799.98 31.98 16330.41 16330.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.00 77.06% 33846.77 28942 44136 33778.77 33240 34191 3678827 5408224 31.98
crit 32.44 22.94% 68711.39 59042 90038 68194.98 65844 70968 2215896 3257576 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 16827 5.9% 30.6 5.42sec 215448 0 Direct 30.6 168104 339229 216997 27.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.56 30.56 0.00 0.00 0.0000 0.0000 6583137.68 9677835.97 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.11 72.36% 168103.77 120171 183260 168260.16 162861 175048 3719811 5468475 31.98
crit 8.44 27.64% 339228.68 245148 373850 339438.94 323799 365270 2863327 4209361 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 12971 4.6% 3.8 118.87sec 1369103 0 Direct 3.6 1119318 2114960 1430456 34.4%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 3.56 0.00 0.00 0.0000 0.0000 5172166.28 5172166.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.33 65.62% 1119318.21 729599 1823118 1103893.76 729599 1823118 2555113 2555113 0.00
crit 1.22 34.38% 2114959.88 1488381 3719161 1682603.61 0 3719161 2617054 2617054 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:563592.40
  • base_dd_max:563592.40
 
Templar's Verdict 107824 38.5% 105.4 3.73sec 406017 372041 Direct 105.4 327082 669399 408398 23.6%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.44 105.44 0.00 0.00 1.0913 0.0000 42812263.10 42812263.10 0.00 372041.15 372041.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.56 76.40% 327082.44 284573 433974 325801.04 320251 330009 26259448 26259448 0.00
crit 24.89 23.60% 669399.26 580529 885307 662763.03 635679 699790 16552815 16552815 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $224266sw1 Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 16163 5.8% 12.4 34.03sec 514530 456447 Direct 12.4 205376 414312 253096 25.0%  
Periodic 73.9 34513 70963 43805 25.9% 18.6%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.44 12.44 73.89 73.89 1.1273 1.0000 6403036.71 6403036.71 0.00 72830.47 456446.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.33 75.00% 205375.93 183169 279332 206399.84 199487 217055 1917571 1917571 0.00
crit 3.11 25.00% 414312.45 373664 569837 362177.18 0 471751 1259870 1259870 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.8 74.14% 34513.37 30998 47271 34254.18 33477 35112 1873735 1873735 0.00
crit 19.1 25.86% 70963.37 63235 96433 70625.12 65914 75207 1351860 1351860 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Zipi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Crusade 3.8 120.17sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:224668
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:224668
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
Judgment (_aoe) 42.1 9.34sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to {$s3=3} other nearby enemies]?s137027[ and {$s2=1} other nearby enemy][], dealing {$s1=1} Holy damage{$?s76672=false}[, and causing them to take $197277s2% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s137029[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?s137028[, and reducing the remaining cooldown on Shield of the Righteous by {$s2=1} sec, or ${$m2*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield of Vengeance 3.8 120.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.78 3.78 0.00 0.00 0.0000 0.0000 0.00 2650136.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 76.47% 0.00 0 0 0.00 0 0 0 1628156 100.00
crit 0.89 23.53% 0.00 0 0 0.00 0 0 0 1021981 77.78
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 37.43% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crusade 3.8 39.0 120.2sec 8.5sec 27.12% 97.65% 24.4(66.2) 3.6

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.59%
  • crusade_4:3.42%
  • crusade_7:3.11%
  • crusade_10:2.78%
  • crusade_13:2.14%
  • crusade_15:15.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224668
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:21.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 121.3sec 0.0sec 12.30% 50.02% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 7.32% 37.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:7.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 3.8 0.0 120.0sec 120.0sec 13.76% 49.17% 0.0(0.0) 3.6

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:13.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
The Fires of Justice 15.9 0.2 21.9sec 21.5sec 10.46% 12.78% 0.2(0.2) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_the_fires_of_justice
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • the_fires_of_justice_1:10.46%

Trigger Attempt Success

  • trigger_pct:14.50%

Spelldata details

  • id:209785
  • name:The Fires of Justice
  • tooltip:Your next damaging or healing Holy Power spender costs {$s2=1} less Holy Power.
  • description:{$@spelldesc203316=Reduces the cooldown of Crusader Strike by ${$m2/-1000}.1 sec and gives it a {$h=15}% chance to reduce the cost of your next damaging or healing Holy Power ability by {$209785s1=1}.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zipi
templars_verdict Holy Power 106.5 302.8 2.8 2.9 141366.4
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 12.46 58.85 (19.28%) 4.72 3.46 5.56%
crusader_strike Holy Power 110.54 110.54 (36.21%) 1.00 0.00 0.00%
blade_of_wrath Holy Power 67.92 135.85 (44.51%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.76 0.76
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 4.00 4.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
the_fires_of_justice 16.1 21.5sec

Statistics & Data Analysis

Fight Length
Sample Data Zipi Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Zipi Damage Per Second
Count 9
Mean 280922.98
Minimum 270373.36
Maximum 295033.24
Spread ( max - min ) 24659.88
Range [ ( max - min ) / 2 * 100% ] 4.39%
Standard Deviation 6767.4128
5th Percentile 270373.36
95th Percentile 285192.64
( 95th Percentile - 5th Percentile ) 14819.29
Mean Distribution
Standard Deviation 2255.8043
95.00% Confidence Intervall ( 276501.68 - 285344.27 )
Normalized 95.00% Confidence Intervall ( 98.43% - 101.57% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 390957
0.05 Scale Factor Error with Delta=300 1563828
0.01 Scale Factor Error with Delta=300 39095701
Priority Target DPS
Sample Data Zipi Priority Target Damage Per Second
Count 9
Mean 280922.98
Minimum 270373.36
Maximum 295033.24
Spread ( max - min ) 24659.88
Range [ ( max - min ) / 2 * 100% ] 4.39%
Standard Deviation 6767.4128
5th Percentile 270373.36
95th Percentile 285192.64
( 95th Percentile - 5th Percentile ) 14819.29
Mean Distribution
Standard Deviation 2255.8043
95.00% Confidence Intervall ( 276501.68 - 285344.27 )
Normalized 95.00% Confidence Intervall ( 98.43% - 101.57% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 390957
0.05 Scale Factor Error with Delta=300 1563828
0.01 Scale Factor Error with Delta=300 39095701
DPS(e)
Sample Data Zipi Damage Per Second (Effective)
Count 9
Mean 280922.98
Minimum 270373.36
Maximum 295033.24
Spread ( max - min ) 24659.88
Range [ ( max - min ) / 2 * 100% ] 4.39%
Damage
Sample Data Zipi Damage
Count 9
Mean 111323570.44
Minimum 93697269.63
Maximum 131819448.34
Spread ( max - min ) 38122178.71
Range [ ( max - min ) / 2 * 100% ] 17.12%
DTPS
Sample Data Zipi Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zipi Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zipi Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zipi Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zipi Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zipi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZipiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zipi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 5.00 auto_attack
0.00 rebuke
7 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
8 3.85 shield_of_vengeance
9 3.85 crusade,if=holy_power>=5
A 1.00 wake_of_ashes,if=holy_power>=0&time<2
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
B 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
C 0.00 call_action_list,name=BoW,if=talent.blade_of_wrath.enabled
D 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.BoW
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
E 47.85 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
F 15.15 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
G 11.46 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_wrath.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.67|cooldown.crusader_strike.charges_fractional<=0.67)
0.00 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4&!talent.the_fires_of_justice.enabled
H 67.92 blade_of_wrath,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
I 71.85 crusader_strike,if=charges=2&holy_power<=4&talent.the_fires_of_justice.enabled
J 42.69 judgment
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
K 7.62 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
L 35.92 templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 zeal,if=holy_power<=4
M 38.69 crusader_strike,if=holy_power<=4

Sample Sequence

0123568A9JEHIEMLHIJLIHLIMHJIEHIEIHEIJHEIKHIJFHFGEHIEJILHIJ6IEHEIJKHILMMHJEIFHFGJEHIELIHJILMHLIMJHEILMHMJFIFGEHIJEIM897JEHJ6IEHFIMFGJEHIEMLHIJLIHLIMHJLIMHEMMJFHFGEIHJEILHILMJHIKMLHIJLIHFGEIHJEIHJ6EHIEMLHIJLIHFGEIHJ89EILHILMMHJLMLHILMMHJKILHIFGEHIJEIHEILHIJKIHLIMMJLHLIMMHJ6EHFGJEHIELIHJILMHLIMJHEILMHMJEIFGEHIJEIHEILMHJI8M9EHLIMMJKHFGEIHEIJKHILMMHEJILHILMMHJKIHEILMHJ

Sample Sequence Table

time name target resources buffs
Pre flask Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power shield_of_vengeance, potion_of_the_old_war
0:01.181 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:01.181 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.100 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:03.019 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:03.854 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:04.690 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:05.525 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), shield_of_vengeance, potion_of_the_old_war
0:06.291 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), shield_of_vengeance, potion_of_the_old_war
0:07.057 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(10), shield_of_vengeance, potion_of_the_old_war
0:07.929 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), shield_of_vengeance, potion_of_the_old_war
0:08.684 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), shield_of_vengeance, potion_of_the_old_war
0:09.439 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), shield_of_vengeance, potion_of_the_old_war
0:10.194 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(13), shield_of_vengeance, potion_of_the_old_war
0:10.949 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), shield_of_vengeance, potion_of_the_old_war
0:11.704 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(13), shield_of_vengeance, potion_of_the_old_war
0:12.457 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), shield_of_vengeance, potion_of_the_old_war
0:13.214 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), shield_of_vengeance, potion_of_the_old_war
0:13.967 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), shield_of_vengeance, potion_of_the_old_war
0:14.960 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), shield_of_vengeance, potion_of_the_old_war
0:15.714 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:16.469 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:17.223 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:18.070 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:18.823 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:19.576 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:20.330 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:21.176 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:21.930 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:22.684 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), potion_of_the_old_war
0:23.439 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15)
0:24.284 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15)
0:25.039 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15)
0:25.792 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), the_fires_of_justice
0:26.547 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15)
0:27.395 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15)
0:28.151 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice
0:28.907 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice
0:29.662 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15)
0:30.502 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15)
0:31.258 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust
0:32.210 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust
0:33.161 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust
0:34.113 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust
0:35.065 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, the_fires_of_justice
0:36.019 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust
0:36.969 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust
0:37.921 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust
0:38.872 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust
0:39.823 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust
0:40.774 Waiting 2.600 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, raid_movement, the_fires_of_justice
0:43.374 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, the_fires_of_justice
0:44.839 Waiting 2.400 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, the_fires_of_justice
0:47.239 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
0:47.239 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
0:48.475 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
0:49.710 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
0:50.948 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
0:52.185 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
0:53.421 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
0:54.696 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
0:55.933 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
0:57.169 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
0:58.405 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
0:59.642 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
1:00.877 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:02.114 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:03.352 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:04.589 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:05.825 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:07.063 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
1:08.301 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
1:09.537 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:10.773 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
1:12.010 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:13.010 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:14.447 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:15.684 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:16.922 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:18.159 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
1:19.394 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:20.634 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
1:21.869 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
1:23.106 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:24.341 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:25.579 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:26.815 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
1:28.052 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:29.288 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:30.524 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
1:31.761 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:32.998 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:34.235 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:35.471 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:36.708 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:37.944 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:39.181 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
1:40.417 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice
1:41.654 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
1:42.891 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
1:44.129 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
1:45.365 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:46.601 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:47.839 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
1:49.075 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:50.312 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:51.548 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:52.784 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
1:54.018 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
1:55.255 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:56.491 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:57.726 Waiting 2.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:59.826 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:00.000 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
2:01.000 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
2:01.181 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance
2:01.181 Waiting 1.300 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance, potion_of_the_old_war
2:02.481 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance, potion_of_the_old_war
2:03.836 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance, potion_of_the_old_war
2:05.030 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, crusade(4), shield_of_vengeance, potion_of_the_old_war
2:06.115 Waiting 5.900 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(4), shield_of_vengeance, potion_of_the_old_war
2:12.015 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(4), shield_of_vengeance, potion_of_the_old_war
2:13.254 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), shield_of_vengeance, potion_of_the_old_war
2:13.254 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), shield_of_vengeance, potion_of_the_old_war
2:14.339 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), shield_of_vengeance, potion_of_the_old_war
2:15.424 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), potion_of_the_old_war
2:16.417 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), potion_of_the_old_war
2:17.411 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), potion_of_the_old_war
2:18.327 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), potion_of_the_old_war
2:19.242 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), potion_of_the_old_war
2:20.157 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), potion_of_the_old_war
2:21.007 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), potion_of_the_old_war
2:21.858 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), potion_of_the_old_war
2:22.707 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), potion_of_the_old_war
2:23.519 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), potion_of_the_old_war
2:24.332 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), potion_of_the_old_war
2:25.145 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), potion_of_the_old_war
2:25.958 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), potion_of_the_old_war
2:26.771 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
2:27.585 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
2:28.397 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
2:29.209 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
2:30.023 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
2:30.835 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15)
2:31.647 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
2:32.884 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
2:34.120 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
2:35.357 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
2:36.593 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:37.831 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:39.067 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
2:40.302 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
2:41.539 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
2:42.775 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:44.011 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
2:45.247 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
2:46.484 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:47.721 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:48.958 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
2:50.192 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
2:51.428 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
2:52.666 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:53.903 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
2:55.139 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
2:56.377 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:57.613 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:58.849 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:00.086 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:01.320 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:02.556 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:03.794 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:05.031 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:06.268 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice
3:07.502 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice
3:08.739 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
3:09.976 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
3:11.212 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:12.448 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:13.684 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:14.922 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:16.157 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:17.392 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:18.628 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:19.866 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
3:21.103 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:22.338 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:23.574 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:24.811 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:26.048 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:27.283 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:28.521 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:29.759 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:30.994 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement
3:31.994 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement
3:33.445 Waiting 3.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement
3:36.945 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement
3:38.377 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:38.377 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:39.614 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:40.850 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
3:42.088 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:43.323 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:44.557 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:45.793 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:47.030 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:48.266 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:49.503 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:50.741 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:51.978 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
3:53.215 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:54.452 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
3:55.689 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:56.927 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
3:58.163 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:59.398 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
4:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
4:00.635 Waiting 0.300 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
4:00.935 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
4:01.181 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance
4:02.375 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), shield_of_vengeance
4:03.460 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), shield_of_vengeance
4:04.545 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(7), shield_of_vengeance
4:05.536 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), shield_of_vengeance
4:06.529 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), shield_of_vengeance
4:07.522 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), shield_of_vengeance
4:08.440 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), shield_of_vengeance
4:09.355 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), shield_of_vengeance
4:10.410 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), shield_of_vengeance
4:11.325 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), shield_of_vengeance
4:12.242 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), shield_of_vengeance
4:13.095 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), the_fires_of_justice, shield_of_vengeance
4:13.946 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), shield_of_vengeance
4:14.871 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), shield_of_vengeance
4:15.685 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
4:16.498 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
4:17.312 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), the_fires_of_justice
4:18.124 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), the_fires_of_justice
4:18.935 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), the_fires_of_justice
4:19.748 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), the_fires_of_justice
4:20.559 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
4:21.373 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
4:22.186 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
4:22.998 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
4:23.811 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
4:24.623 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
4:25.436 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
4:26.248 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
4:27.062 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15)
4:27.874 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
4:28.686 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
4:29.500 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
4:30.314 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
4:31.125 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
4:31.935 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:33.171 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
4:34.407 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
4:35.643 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:36.878 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
4:38.114 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
4:39.348 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
4:40.584 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:41.818 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
4:43.054 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
4:44.291 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:45.526 Waiting 0.200 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
4:45.726 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
4:47.166 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
4:48.401 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
4:49.639 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
4:50.875 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
4:52.112 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
4:53.348 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
4:54.586 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:54.786 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
4:56.224 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement
4:57.461 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement
4:58.699 Waiting 3.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement
5:02.199 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:02.199 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:03.434 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:04.670 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:05.906 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:07.141 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:08.555 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:09.790 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:11.027 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:12.263 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
5:13.499 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:14.737 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
5:15.974 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:17.210 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:18.448 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:19.684 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:20.920 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:22.156 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:23.394 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:24.632 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:25.868 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice
5:27.104 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
5:28.342 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
5:29.580 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
5:30.815 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:32.052 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:33.288 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:34.525 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:35.763 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:36.999 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:38.234 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:39.472 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:40.709 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:41.945 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
5:43.180 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:44.415 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:45.653 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
5:46.889 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:48.126 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:49.362 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:50.601 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:51.838 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
5:53.076 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
5:54.313 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:55.548 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power
5:56.785 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
5:58.022 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
5:59.259 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
6:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance
6:00.497 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance
6:01.735 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
6:01.735 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, shield_of_vengeance
6:02.930 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), shield_of_vengeance
6:04.032 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), shield_of_vengeance
6:05.118 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), shield_of_vengeance
6:06.112 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), shield_of_vengeance
6:07.104 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), shield_of_vengeance
6:07.204 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), shield_of_vengeance
6:08.421 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), the_fires_of_justice, shield_of_vengeance
6:09.415 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), the_fires_of_justice, shield_of_vengeance
6:10.410 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), shield_of_vengeance
6:11.328 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), shield_of_vengeance
6:12.245 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), shield_of_vengeance
6:13.096 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), shield_of_vengeance
6:13.948 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), shield_of_vengeance
6:14.761 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), shield_of_vengeance
6:15.786 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
6:16.599 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
6:17.413 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice
6:18.226 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice
6:19.038 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15)
6:19.851 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
6:20.662 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15)
6:21.474 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15)
6:22.287 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
6:23.100 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
6:23.913 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15)
6:24.725 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
6:25.539 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
6:26.350 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
6:27.163 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
6:27.975 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15)
6:28.787 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15)
6:29.599 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15)
6:30.411 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), the_fires_of_justice
6:31.222 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), the_fires_of_justice
6:32.035 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
6:33.274 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
6:34.512 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
6:35.749 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
6:36.985 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
6:38.220 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
6:39.457 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
6:40.693 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power
6:41.929 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
6:43.167 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27101 25394 13955 (9994)
Agility 3198 3198 0
Stamina 34208 34208 20906
Intellect 7326 7326 0
Spirit 0 0 0
Health 2052480 2052480 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 27101 25394 0
Crit 24.13% 24.13% 6694
Haste 21.72% 20.56% 6683
Damage / Heal Versatility 3.98% 3.98% 1592
Attack Power 27101 25394 0
Mastery 27.07% 27.07% 3517
Armor 4117 4117 4117
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 856.00
Local Head Greystone Helm
ilevel: 835, stats: { 536 Armor, +1128 StrInt, +1692 Sta, +723 Haste, +511 Crit }
Local Neck Pendant of the Watchful Eye
ilevel: 825, stats: { +867 Sta, +1099 Haste, +573 Crit }
Local Shoulders Nightsfall Shoulderplates
ilevel: 870, stats: { 535 Armor, +1172 StrInt, +1758 Sta, +618 Haste, +437 Mastery }
Local Chest Nightsfall Brestplate
ilevel: 840, stats: { 668 Armor, +1182 StrInt, +1773 Sta, +817 Haste, +440 Mastery }
Local Waist Chain of Thrayn
ilevel: 895, stats: { 424 Armor, +2219 Sta, +1479 StrInt, +413 Crit, +745 Haste }
Local Legs Wracksoul Legplates
ilevel: 845, stats: { 591 Armor, +1238 StrInt, +1857 Sta, +888 Crit, +393 Haste }
Local Feet Warboots of Smoldering Fury
ilevel: 860, stats: { 480 Armor, +1601 Sta, +1068 StrInt, +661 Haste, +355 Mastery }
Local Wrists Wristclamps of Mad Dreams
ilevel: 870, stats: { 312 Armor, +1319 Sta, +879 StrInt, +481 Crit, +311 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1678 Sta, +1119 StrInt, +673 Haste, +362 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 850, stats: { +1094 Sta, +1049 Crit, +786 Vers }
Local Finger2 Ring of Minute Mirrors
ilevel: 875, stats: { +1381 Sta, +1210 Mastery, +806 Vers }, gems: { +150 Haste }
Local Trinket1 Brulstone Idol
ilevel: 840, stats: { +1123 Str, +898 Crit }
Local Trinket2 An'she's Invigoring Charm
ilevel: 840, stats: { +1123 Str, +898 Crit }
Local Back Evergreen Vinewrap Drape
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +493 Haste, +241 Crit }
Local Main Hand Ashbringer
ilevel: 880, weapon: { 8875 - 13315, 3.6 }, stats: { +1715 Str, +2573 Sta, +742 Crit, +713 Mastery }, relics: { +45 ilevels, +48 ilevels, +37 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Zipi"
origin="https://us.api.battle.net/wow/character/thrall/Zipi/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/146/160036754-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=mining=317/herbalism=363
talents=http://us.battle.net/wow/en/tool/talent-calculator#bb!0001001
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:50:3:51:3:53:3:350:1:353:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=BoW,if=talent.blade_of_wrath.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.BoW=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_wrath.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.67|cooldown.crusader_strike.charges_fractional<=0.67)
actions.BoW+=/zeal,if=charges=2&holy_power<=4
actions.BoW+=/crusader_strike,if=charges=2&holy_power<=4&!talent.the_fires_of_justice.enabled
actions.BoW+=/blade_of_wrath,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.BoW+=/crusader_strike,if=charges=2&holy_power<=4&talent.the_fires_of_justice.enabled
actions.BoW+=/judgment
actions.BoW+=/consecration
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/zeal,if=holy_power<=4
actions.BoW+=/crusader_strike,if=holy_power<=4

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=greystone_helm,id=139096,bonus_id=3432/1497/1674
neck=pendant_of_the_watchful_eye,id=137536,bonus_id=1726/1477
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3432/1532/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1472
chest=nightsfall_brestplate,id=139055,bonus_id=3432/1808/1502/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1807/1492/3337
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=chain_of_thrayn,id=137086,bonus_id=1811
legs=wracksoul_legplates,id=121280,bonus_id=3432/1507/3336
feet=warboots_of_smoldering_fury,id=141437,bonus_id=1472
finger1=grubby_silver_ring,id=139236,bonus_id=1807/1472
finger2=ring_of_minute_mirrors,id=137533,bonus_id=3410/1808/1527/3337,gems=150haste
trinket1=brulstone_idol,id=134146,bonus_id=3396/603/1502/3337
trinket2=anshes_invigoring_charm,id=139102,bonus_id=3397/603/1502/3336
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=141276/141522/141260/0,relic_id=3397:1517:3337/1477:3336/3396:1492:3339/0

# Gear Summary
# gear_ilvl=856.00
# gear_strength=13955
# gear_stamina=20906
# gear_crit_rating=6694
# gear_haste_rating=6683
# gear_mastery_rating=3517
# gear_versatility_rating=1592
# gear_armor=4117

Raji

Raji : 234844 dps

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
234844.5 234844.5 1774.3 / 0.756% 6055.0 / 2.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.03% 41.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 755
  • enchanting: 714

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 234844
Deadly Grace 8545 3.6% 29.1 13.37sec 114921 0 Direct 29.1 90609 176486 115011 28.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.11 29.11 0.00 0.00 0.0000 0.0000 3345483.62 3345483.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.89 71.76% 90608.53 82087 98504 90615.79 88511 92250 1893463 1893463 0.00
crit 8.22 28.24% 176486.12 164173 197008 176758.29 168864 183874 1452020 1452020 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 19369 8.2% 49.3 8.02sec 155480 150096 Direct 50.3 116387 232070 151267 31.1%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.33 50.33 0.00 0.00 1.0359 0.0000 7670347.96 7670347.96 0.00 150095.84 150095.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.67 68.87% 116387.50 96647 139172 116085.58 114688 117722 4026106 4026106 0.00
crit 15.67 31.13% 232069.74 193294 278344 232822.60 227884 236371 3644242 3644242 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage. |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 29740 12.7% 109.9 3.59sec 107550 62277 Periodic 340.2 27157 54604 34772 27.5% 44.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.89 0.00 340.22 340.22 1.7270 0.5154 11818533.95 11818533.95 0.00 62276.56 62276.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 246.8 72.53% 27157.10 23149 33403 27130.79 26794 27376 6697589 6697589 0.00
crit 93.4 27.47% 54604.23 46299 66806 54838.82 53243 56081 5120945 5120945 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.] |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.600000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 7452 3.2% 13.8 9.97sec 215601 204004 Direct 13.8 167202 336463 216765 29.0%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.78 13.78 0.00 0.00 1.0569 0.0000 2970496.80 2970496.80 0.00 204003.63 204003.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.78 70.97% 167202.44 119457 172018 166835.14 161864 169629 1632579 1632579 0.00
crit 4.00 29.03% 336462.97 286697 344036 336163.31 327653 344036 1337918 1337918 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 31952 13.6% 23.1 14.54sec 547730 533288 Direct 23.1 29901 58800 38734 32.2%  
Periodic 285.9 32216 64322 41152 27.6% 99.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.11 23.11 285.89 285.89 1.0271 1.3768 12658656.45 12658656.45 0.00 30331.61 533287.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.67 67.79% 29900.85 26538 38215 29824.30 28838 30936 467077 467077 0.00
crit 7.44 32.21% 58800.01 53077 76431 59834.37 55731 66665 444195 444195 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 207.1 72.44% 32216.38 4268 38215 32182.39 31882 32493 6666793 6666793 0.00
crit 78.8 27.56% 64322.10 39116 76431 64532.83 62951 65917 5080592 5080592 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.{$?s137033=false}[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 8504 3.6% 113.8 3.27sec 29662 0 Direct 112.4 23380 46734 30105 28.1%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.78 112.44 0.00 0.00 0.0000 0.0000 3374832.83 3374832.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.89 71.94% 23379.66 19329 27834 23363.79 23175 23649 1888958 1888958 0.00
crit 31.56 28.06% 46733.86 38659 55669 47058.32 45324 48078 1485875 1485875 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 37939 16.2% 1.0 0.00sec 15066010 15515973 Periodic 189.4 61018 121178 78781 30.8% 99.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 189.44 189.44 0.9716 2.0721 15066010.01 15066010.01 0.00 38286.12 15515973.23
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.1 69.21% 61017.93 50002 72002 61098.84 60469 61578 8013797 8013797 0.00
crit 58.3 30.79% 121177.87 100003 144004 120928.79 119185 123853 7052213 7052213 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.870000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 40068 17.1% 74.4 5.06sec 213321 202561 Direct 74.3 163188 327474 211915 30.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.44 74.33 0.00 0.00 1.0531 0.0000 15880576.57 15880576.57 0.00 202560.96 202560.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.44 69.21% 163187.95 151725 182070 163533.83 161347 165272 8415694 8415694 0.00
crit 22.89 30.79% 327473.67 303451 364141 325705.35 315589 332476 7464882 7464882 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage and refreshing Shadow Word: Pain and Vampiric Touch to their original duration. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 3727 1.6% 11.0 36.56sec 135699 0 Direct 22.0 51114 102870 66748 32.3%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 22.00 0.00 0.00 0.0000 0.0000 1492694.32 1492694.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.89 67.68% 51113.52 48325 57990 51242.32 50396 52042 762455 762455 0.00
crit 7.11 32.32% 102870.38 96649 115979 102617.83 98797 106314 730239 730239 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 13832 5.8% 6.7 63.66sec 815449 191954 Periodic 46.3 91975 187076 119380 26.9% 6.7%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.67 0.00 46.33 46.33 4.2483 0.5755 5436328.64 5436328.64 0.00 191953.98 191953.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.9 73.14% 91975.19 3426 111339 91980.66 86516 99431 3109416 3109416 0.00
crit 12.4 26.86% 187076.28 9326 222678 188558.45 169427 203247 2326913 2326913 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.400000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 6220 2.7% 21.8 15.89sec 113367 0 Direct 21.8 95931 193480 118863 17.3%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.78 21.78 0.00 0.00 0.0000 0.0000 2468888.69 2468888.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.00 82.65% 95930.91 89525 107429 96421.91 92352 98477 1732798 1732798 0.00
crit 3.78 17.35% 193479.97 179049 214859 196158.28 186211 214859 736091 736091 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=54194} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:86347.37
  • base_dd_max:86347.37
 
pet - mindbender 63216 / 16427
melee 63216 7.0% 92.4 4.21sec 70412 65971 Direct 92.4 53411 106994 70004 31.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.44 92.44 0.00 0.00 1.0673 0.0000 6509207.11 6509207.11 0.00 65971.47 65971.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.11 68.27% 53411.40 47376 54482 53427.97 53084 53799 3371333 3371333 0.00
crit 29.33 31.73% 106994.09 94752 108965 107015.62 105534 108153 3137874 3137874 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 37411 / 9274
Mind Flay (_void_tendril) 37411 (40199) 3.9% (5.2%) 9.8 39.32sec 492171 54686 Periodic 88.0 31585 63170 41279 31.9% 22.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.78 0.00 88.00 88.00 9.0000 1.0000 3667378.18 3667378.18 0.00 54685.65 54685.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.9 68.06% 31585.08 31585 31585 31585.08 31585 31585 1891595 1891595 0.00
crit 28.1 31.94% 63170.15 63170 63170 63170.15 63170 63170 1775783 1775783 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 34744 0.8% 2.1 61.62sec 360441 40049 Periodic 19.1 31585 63170 40148 26.8% 4.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.12 0.00 19.12 19.12 9.0000 1.0000 765938.07 765938.07 0.00 40049.05 40049.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.0 73.20% 31585.08 31585 31585 31585.08 31585 31585 442191 442191 0.00
crit 5.1 26.80% 63170.15 63170 63170 63170.15 63170 63170 323747 323747 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 37902 0.4% 1.0 0.00sec 379021 42113 Periodic 9.0 31585 63170 42113 33.3% 2.3%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 379020.90 379020.90 0.00 42113.43 42113.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.0 66.67% 31585.08 31585 31585 31585.08 31585 31585 189510 189510 0.00
crit 3.0 33.33% 63170.15 63170 63170 63170.15 63170 63170 189510 189510 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.6 186.62sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.2 60.38sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.22 0.00 0.00 0.00 1.1115 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - mindbender
Shadowcrawl 20.9 19.13sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.89 0.00 0.00 0.00 1.0906 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.6 0.0 188.4sec 188.4sec 6.40% 8.19% 0.0(0.0) 2.6

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 14.02% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.0 245.4 36.0sec 36.0sec 69.29% 80.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:4.82%
  • insanity_drain_stacks_2:2.90%
  • insanity_drain_stacks_3:2.76%
  • insanity_drain_stacks_4:3.26%
  • insanity_drain_stacks_5:2.95%
  • insanity_drain_stacks_6:2.74%
  • insanity_drain_stacks_7:2.74%
  • insanity_drain_stacks_8:3.82%
  • insanity_drain_stacks_9:2.74%
  • insanity_drain_stacks_10:2.74%
  • insanity_drain_stacks_11:2.74%
  • insanity_drain_stacks_12:2.74%
  • insanity_drain_stacks_13:2.86%
  • insanity_drain_stacks_14:2.84%
  • insanity_drain_stacks_15:2.73%
  • insanity_drain_stacks_16:2.80%
  • insanity_drain_stacks_17:2.48%
  • insanity_drain_stacks_18:2.60%
  • insanity_drain_stacks_19:2.40%
  • insanity_drain_stacks_20:2.25%
  • insanity_drain_stacks_21:1.88%
  • insanity_drain_stacks_22:1.91%
  • insanity_drain_stacks_23:1.36%
  • insanity_drain_stacks_24:1.30%
  • insanity_drain_stacks_25:1.22%
  • insanity_drain_stacks_26:1.00%
  • insanity_drain_stacks_27:0.83%
  • insanity_drain_stacks_28:0.60%
  • insanity_drain_stacks_29:0.57%
  • insanity_drain_stacks_30:0.21%
  • insanity_drain_stacks_31:0.35%
  • insanity_drain_stacks_32:0.13%
  • insanity_drain_stacks_33:0.14%
  • insanity_drain_stacks_34:0.09%
  • insanity_drain_stacks_35:0.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.0 0.0 35.4sec 35.4sec 28.61% 53.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_15:0.21%
  • lingering_insanity_16:1.39%
  • lingering_insanity_17:2.19%
  • lingering_insanity_18:0.71%
  • lingering_insanity_19:0.56%
  • lingering_insanity_20:1.52%
  • lingering_insanity_21:0.97%
  • lingering_insanity_22:1.73%
  • lingering_insanity_23:0.40%
  • lingering_insanity_24:2.45%
  • lingering_insanity_25:1.23%
  • lingering_insanity_26:1.89%
  • lingering_insanity_27:1.68%
  • lingering_insanity_28:1.62%
  • lingering_insanity_29:2.12%
  • lingering_insanity_30:0.79%
  • lingering_insanity_31:3.31%
  • lingering_insanity_32:1.98%
  • lingering_insanity_33:0.78%
  • lingering_insanity_34:0.20%
  • lingering_insanity_38:0.99%
  • lingering_insanity_40:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 359.1sec 0.0sec 12.30% 49.29% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 7.32% 43.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:7.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 1.0 145.6 0.0sec 0.9sec 34.97% 63.28% 145.6(145.6) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:34.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.7 0.0 63.9sec 63.9sec 6.75% 6.75% 0.0(0.0) 6.7

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.0 0.0 36.0sec 36.0sec 69.29% 67.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.76%
  • voidform_2:2.76%
  • voidform_3:2.76%
  • voidform_4:2.76%
  • voidform_5:2.75%
  • voidform_6:2.74%
  • voidform_7:2.74%
  • voidform_8:2.74%
  • voidform_9:2.74%
  • voidform_10:2.74%
  • voidform_11:2.74%
  • voidform_12:2.74%
  • voidform_13:2.74%
  • voidform_14:2.74%
  • voidform_15:2.73%
  • voidform_16:2.68%
  • voidform_17:2.50%
  • voidform_18:2.36%
  • voidform_19:2.28%
  • voidform_20:2.17%
  • voidform_21:2.05%
  • voidform_22:1.95%
  • voidform_23:1.85%
  • voidform_24:1.74%
  • voidform_25:1.55%
  • voidform_26:1.45%
  • voidform_27:1.24%
  • voidform_28:1.09%
  • voidform_29:0.93%
  • voidform_30:0.78%
  • voidform_31:0.56%
  • voidform_32:0.31%
  • voidform_33:0.16%
  • voidform_34:0.15%
  • voidform_35:0.14%
  • voidform_36:0.14%
  • voidform_37:0.14%
  • voidform_38:0.09%
  • voidform_39:0.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 20.9 0.0 19.1sec 19.1sec 86.72% 69.62% 0.0(0.0) 13.7

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 111.92 441.02 (893.80%) 3.94 6.67 1.49%
Insanity Drained by Voidform Insanity 5501.38 -3948.78 (-8002.83%) -0.72 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 50.77 606.57 (1229.31%) 11.95 2.66 0.44%
Insanity Gained from Mind Flay Insanity 341.31 682.42 (1383.04%) 2.00 0.19 0.03%
Insanity Gained from Mindbender Insanity 93.15 361.42 (732.47%) 3.88 11.20 3.00%
Insanity Gained from Shadow Word: Death Insanity 13.92 377.93 (765.94%) 27.14 39.76 9.52%
Insanity Gained from Shadow Word: Pain Casts Insanity 23.15 69.46 (140.77%) 3.00 0.00 0.00%
Insanity Gained from Vampiric Touch Casts Insanity 1.00 4.00 (8.11%) 4.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 74.77 1136.81 (2303.92%) 15.20 59.50 4.97%
Insanity Saved by Void Torrent Insanity 515.62 318.49 (645.47%) 0.62 0.00 0.00%
Health from Vampiric Touch Ticks Health 189.92 0.00 (0.00%) 0.00 7481148.74 100.00%
mp5_regen Mana 519.38 0.00 (0.00%) 0.00 3493955.38 100.00%
Resource RPS-Gain RPS-Loss
Insanity 10.08 9.95
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 51.00 40.00 62.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 113.8 3.5sec
Void Eruption casted when a target with both DoTs was up 11.0 36.0sec
Void Tendril spawned from Call to the Void 11.8 33.3sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Raji Damage Per Second
Count 9
Mean 234844.46
Minimum 231660.46
Maximum 239595.83
Spread ( max - min ) 7935.37
Range [ ( max - min ) / 2 * 100% ] 1.69%
Standard Deviation 2715.8061
5th Percentile 231660.46
95th Percentile 237715.44
( 95th Percentile - 5th Percentile ) 6054.98
Mean Distribution
Standard Deviation 905.2687
95.00% Confidence Intervall ( 233070.17 - 236618.75 )
Normalized 95.00% Confidence Intervall ( 99.24% - 100.76% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 513
0.1 Scale Factor Error with Delta=300 62962
0.05 Scale Factor Error with Delta=300 251849
0.01 Scale Factor Error with Delta=300 6296238
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9
Mean 234844.46
Minimum 231660.46
Maximum 239595.83
Spread ( max - min ) 7935.37
Range [ ( max - min ) / 2 * 100% ] 1.69%
Standard Deviation 2715.8061
5th Percentile 231660.46
95th Percentile 237715.44
( 95th Percentile - 5th Percentile ) 6054.98
Mean Distribution
Standard Deviation 905.2687
95.00% Confidence Intervall ( 233070.17 - 236618.75 )
Normalized 95.00% Confidence Intervall ( 99.24% - 100.76% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 513
0.1 Scale Factor Error with Delta=300 62962
0.05 Scale Factor Error with Delta=300 251849
0.01 Scale Factor Error with Delta=300 6296238
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9
Mean 234844.46
Minimum 231660.46
Maximum 239595.83
Spread ( max - min ) 7935.37
Range [ ( max - min ) / 2 * 100% ] 1.69%
Damage
Sample Data Raji Damage
Count 9
Mean 82182849.83
Minimum 69250910.90
Maximum 100624636.05
Spread ( max - min ) 31373725.15
Range [ ( max - min ) / 2 * 100% ] 19.09%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
7 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
8 0.00 call_action_list,name=vf,if=buff.voidform.up
9 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
A 3.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.23 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.00 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 11.08 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
E 1.92 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 15.85 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
G 19.08 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
H 11.23 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
I 4.15 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
J 2.54 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
K 4.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
L 0.15 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
M 70.62 void_bolt
N 6.62 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
O 4.85 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
P 34.54 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
Q 7.15 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
R 0.46 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
S 62.23 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
T 9.23 shadow_word_pain

Sample Sequence

01245ABCGFGDNKPSMSJMPSMSMPSMSMPSMSMPSMSMPGHHHHHHHFGDSMPSMISMPSMSMNMPSMSMPGFGDSKPSMSMPSMSFGAFGBDTTMTTMNMPSMSMPSMSMPGFGDSKPSMSMPSMSAFGDSMNMPJSMSMPSMSMTTMTTHHFGFGDSKSMPSMSIFGDSMNMPSMQSMPSMSMPQMSMFGEGFDSMSMPQMTTMIOMPSMOSMPSGFGFDNKQRMPSMSMPQMSMPSMOSMOPGAFDSMS6MPQMSMJPSMSMNMPQMSMOPG

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.202 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.174 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.146 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.260 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.233 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:09.008 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, potion_of_deadly_grace
0:09.008 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:13.292 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity bloodlust, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:14.219 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity bloodlust, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:15.135 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:16.042 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:16.958 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:19.002 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.6/100: 75% insanity bloodlust, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:19.002 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.6/100: 75% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:19.771 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:20.533 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity bloodlust, berserking, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:21.288 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, berserking, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:22.054 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, berserking, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:23.804 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity bloodlust, berserking, voidform(15), insanity_drain_stacks(12)
0:24.558 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity bloodlust, berserking, voidform(16), insanity_drain_stacks(13)
0:25.313 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:26.068 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(15)
0:26.823 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(15)
0:28.552 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.5/100: 68% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(17)
0:29.353 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:30.156 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity bloodlust, voidform(22), insanity_drain_stacks(19)
0:30.955 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.8/100: 58% insanity bloodlust, voidform(22), insanity_drain_stacks(19)
0:31.754 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:33.561 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.5/100: 40% insanity bloodlust, voidform(25), insanity_drain_stacks(22)
0:34.340 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.9/100: 46% insanity bloodlust, voidform(26), insanity_drain_stacks(23)
0:35.113 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity bloodlust, voidform(27), insanity_drain_stacks(24)
0:35.879 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.9/100: 31% insanity bloodlust, voidform(27), insanity_drain_stacks(24)
0:36.650 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity bloodlust, voidform(28), insanity_drain_stacks(25)
0:38.421 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.0/100: 9% insanity bloodlust, voidform(30), insanity_drain_stacks(27)
0:39.174 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.5/100: 8% insanity bloodlust, voidform(31), insanity_drain_stacks(28)
0:39.931 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, lingering_insanity(31)
0:40.898 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, raid_movement, lingering_insanity(31)
0:41.848 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity raid_movement, lingering_insanity(31)
0:42.813 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity raid_movement, lingering_insanity(31)
0:43.778 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.0/100: 21% insanity raid_movement, lingering_insanity(31)
0:44.744 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity raid_movement, lingering_insanity(31)
0:45.708 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, lingering_insanity(31)
0:46.673 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, lingering_insanity(31)
0:47.637 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity lingering_insanity(31)
0:48.601 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity lingering_insanity(31)
0:52.216 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity lingering_insanity(31)
0:52.216 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity voidform, insanity_drain_stacks
0:54.931 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity voidform(3), insanity_drain_stacks(3)
0:56.156 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity voidform(4), insanity_drain_stacks(4)
0:57.369 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.2/100: 72% insanity voidform(6), insanity_drain_stacks(6)
0:58.560 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.3/100: 67% insanity voidform(7), insanity_drain_stacks(7)
0:59.777 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity voidform(8), insanity_drain_stacks(8)
1:01.166 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity voidform(9), insanity_drain_stacks(9)
1:02.323 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.4/100: 47% insanity voidform(11), insanity_drain_stacks(11)
1:03.462 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity voidform(12), insanity_drain_stacks(12)
1:04.589 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.5/100: 59% insanity voidform(13), insanity_drain_stacks(13)
1:05.706 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity voidform(14), insanity_drain_stacks(14)
1:06.831 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.1/100: 53% insanity voidform(15), insanity_drain_stacks(15)
1:09.293 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.8/100: 45% insanity voidform(18), insanity_drain_stacks(18)
1:10.362 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity voidform(19), insanity_drain_stacks(19)
1:14.636 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity voidform(23), insanity_drain_stacks(19)
1:15.663 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity voidform(24), insanity_drain_stacks(20)
1:16.682 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity voidform(25), insanity_drain_stacks(21)
1:17.694 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity voidform(26), insanity_drain_stacks(22)
1:18.706 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity voidform(27), insanity_drain_stacks(23)
1:20.886 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.7/100: 17% insanity voidform(29), insanity_drain_stacks(25)
1:21.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.8/100: 13% insanity voidform(30), insanity_drain_stacks(26)
1:22.835 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(31)
1:29.284 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(31)
1:30.249 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity lingering_insanity(31)
1:33.801 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(31)
1:33.801 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity voidform, insanity_drain_stacks
1:36.589 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity voidform(3), insanity_drain_stacks(3)
1:37.815 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity voidform(5), insanity_drain_stacks(5)
1:39.018 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity voidform(6), insanity_drain_stacks(6)
1:40.209 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity voidform(7), insanity_drain_stacks(7)
1:41.433 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.7/100: 61% insanity voidform(8), insanity_drain_stacks(8)
1:43.967 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.7/100: 36% insanity voidform(11), insanity_drain_stacks(11)
1:45.105 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.6/100: 40% insanity voidform(12), insanity_drain_stacks(12)
1:46.233 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.7/100: 36% insanity voidform(13), insanity_drain_stacks(13)
1:47.351 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.5/100: 22% insanity voidform(14), insanity_drain_stacks(14)
1:48.475 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.3/100: 21% insanity voidform(15), insanity_drain_stacks(15)
1:50.921 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(17)
1:52.000 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(17)
1:59.762 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(17)
2:01.079 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(17)
2:02.158 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(17)
2:03.965 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(17)
2:05.043 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity raid_movement, lingering_insanity(17)
2:05.043 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity raid_movement, voidform, insanity_drain_stacks
2:06.293 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity raid_movement, voidform(2), insanity_drain_stacks(2)
2:07.529 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
2:08.760 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
2:09.974 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity raid_movement, voidform(5), insanity_drain_stacks(5)
2:11.176 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity raid_movement, voidform(7), insanity_drain_stacks(7)
2:12.376 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity voidform(8), insanity_drain_stacks(8)
2:16.502 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity voidform(12), insanity_drain_stacks(8)
2:17.632 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity voidform(13), insanity_drain_stacks(9)
2:18.749 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity voidform(14), insanity_drain_stacks(10)
2:19.857 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity voidform(15), insanity_drain_stacks(11)
2:20.969 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity voidform(16), insanity_drain_stacks(12)
2:23.255 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity voidform(19), insanity_drain_stacks(15)
2:24.317 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.2/100: 53% insanity voidform(20), insanity_drain_stacks(16)
2:25.369 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity voidform(21), insanity_drain_stacks(17)
2:26.413 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity voidform(22), insanity_drain_stacks(18)
2:27.460 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.9/100: 40% insanity voidform(23), insanity_drain_stacks(19)
2:29.881 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.8/100: 4% insanity voidform(25), insanity_drain_stacks(21)
2:30.892 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.8/100: 1% insanity voidform(26), insanity_drain_stacks(22)
2:31.896 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(26)
2:38.487 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity lingering_insanity(26)
2:39.489 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(26)
2:44.116 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(26)
2:44.116 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity voidform, insanity_drain_stacks
2:46.824 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity voidform(3), insanity_drain_stacks(3)
2:48.049 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity voidform(4), insanity_drain_stacks(4)
2:49.262 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity voidform(6), insanity_drain_stacks(6)
2:50.453 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.2/100: 56% insanity voidform(7), insanity_drain_stacks(7)
2:51.667 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.3/100: 57% insanity voidform(8), insanity_drain_stacks(8)
2:54.296 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity voidform(11), insanity_drain_stacks(11)
2:55.433 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.6/100: 32% insanity voidform(12), insanity_drain_stacks(12)
2:56.560 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.7/100: 28% insanity voidform(13), insanity_drain_stacks(13)
2:57.676 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.5/100: 14% insanity voidform(14), insanity_drain_stacks(14)
2:58.802 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.3/100: 13% insanity voidform(15), insanity_drain_stacks(15)
3:01.227 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity lingering_insanity(16)
3:02.316 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity lingering_insanity(16)
3:03.405 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(16)
3:08.498 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(16)
3:08.498 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity voidform, insanity_drain_stacks
3:11.286 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.4/100: 66% insanity voidform(3), insanity_drain_stacks(3)
3:12.513 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity voidform(5), insanity_drain_stacks(5)
3:16.723 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity voidform(9), insanity_drain_stacks(5)
3:17.883 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity voidform(10), insanity_drain_stacks(6)
3:19.030 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity voidform(11), insanity_drain_stacks(7)
3:19.030 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity berserking, voidform(11), insanity_drain_stacks(7)
3:20.019 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity berserking, voidform(12), insanity_drain_stacks(8)
3:21.000 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity berserking, voidform(13), insanity_drain_stacks(9)
3:23.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.3/100: 72% insanity berserking, voidform(15), insanity_drain_stacks(11)
3:24.168 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity berserking, voidform(16), insanity_drain_stacks(12)
3:25.116 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity berserking, voidform(17), insanity_drain_stacks(13)
3:26.056 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity berserking, voidform(18), insanity_drain_stacks(14)
3:26.996 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity berserking, voidform(19), insanity_drain_stacks(15)
3:29.091 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.6/100: 51% insanity voidform(21), insanity_drain_stacks(17)
3:30.133 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.7/100: 49% insanity raid_movement, voidform(22), insanity_drain_stacks(18)
3:31.167 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.2/100: 33% insanity raid_movement, voidform(23), insanity_drain_stacks(19)
3:32.193 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.2/100: 18% insanity raid_movement, voidform(24), insanity_drain_stacks(20)
3:33.228 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.5/100: 19% insanity raid_movement, voidform(25), insanity_drain_stacks(21)
3:34.239 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.5/100: 7% insanity raid_movement, voidform(26), insanity_drain_stacks(22)
3:35.236 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(27)
3:36.231 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, lingering_insanity(27)
3:37.227 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(27)
3:38.222 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(27)
3:44.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(27)
3:45.927 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity lingering_insanity(27)
3:47.645 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(27)
3:47.645 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity voidform, insanity_drain_stacks
3:50.450 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.9/100: 56% insanity voidform(3), insanity_drain_stacks(3)
3:51.676 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.9/100: 68% insanity voidform(5), insanity_drain_stacks(5)
3:54.386 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.4/100: 49% insanity voidform(7), insanity_drain_stacks(7)
3:55.565 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity voidform(8), insanity_drain_stacks(8)
3:56.734 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.1/100: 52% insanity voidform(10), insanity_drain_stacks(10)
3:57.882 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity voidform(11), insanity_drain_stacks(11)
3:59.049 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.1/100: 40% insanity voidform(12), insanity_drain_stacks(12)
4:01.629 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.4/100: 10% insanity voidform(14), insanity_drain_stacks(14)
4:02.732 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(15)
4:03.829 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(15)
4:10.030 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(15)
4:10.030 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity voidform, insanity_drain_stacks
4:12.791 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity voidform(3), insanity_drain_stacks(3)
4:14.018 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity voidform(4), insanity_drain_stacks(4)
4:18.297 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity voidform(9), insanity_drain_stacks(5)
4:19.457 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity voidform(10), insanity_drain_stacks(6)
4:20.603 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity voidform(11), insanity_drain_stacks(7)
4:21.742 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.5/100: 83% insanity voidform(12), insanity_drain_stacks(8)
4:22.885 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.8/100: 84% insanity voidform(13), insanity_drain_stacks(9)
4:24.004 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
4:25.113 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.3/100: 78% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
4:26.215 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, voidform(17), insanity_drain_stacks(13)
4:27.293 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity twist_of_fate, voidform(18), insanity_drain_stacks(14)
4:28.364 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity twist_of_fate, voidform(19), insanity_drain_stacks(15)
4:29.443 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.5/100: 60% insanity twist_of_fate, voidform(20), insanity_drain_stacks(16)
4:31.835 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.2/100: 32% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
4:32.869 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.4/100: 30% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
4:33.897 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.5/100: 23% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
4:34.917 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.6/100: 35% insanity twist_of_fate, voidform(25), insanity_drain_stacks(21)
4:35.939 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.6/100: 35% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
4:38.139 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.5/100: 3% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25)
4:39.117 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(30)
4:40.088 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(30)
4:43.277 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity twist_of_fate, lingering_insanity(30)
4:44.247 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, lingering_insanity(30)
4:45.998 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(30)
4:46.971 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(30)
4:46.971 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, voidform, insanity_drain_stacks
4:49.688 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:50.915 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
4:53.558 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.2/100: 49% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
4:54.739 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
4:55.908 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.1/100: 40% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(9)
4:57.067 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity raid_movement, twist_of_fate, voidform(11), insanity_drain_stacks(11)
4:58.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity raid_movement, twist_of_fate, voidform(12), insanity_drain_stacks(12)
4:59.349 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity raid_movement, twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:00.466 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.9/100: 28% insanity raid_movement, twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:01.592 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity raid_movement, twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:02.727 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.6/100: 8% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:03.815 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:04.894 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.3/100: 33% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:05.964 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.4/100: 30% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:07.026 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.5/100: 19% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:08.084 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.6/100: 19% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:09.120 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:10.146 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.4/100: 20% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:11.177 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.2/100: 19% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25)
5:12.186 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.2/100: 14% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26)
5:13.186 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, lingering_insanity(27)
5:16.277 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity twist_of_fate, lingering_insanity(27)
5:17.270 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, lingering_insanity(27)
5:23.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(27)
5:24.927 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, lingering_insanity(27)
5:24.927 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, voidform, insanity_drain_stacks
5:29.176 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity twist_of_fate, voidform(5), insanity_drain_stacks(2)
5:30.378 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity twist_of_fate, voidform(6), insanity_drain_stacks(3)
5:31.569 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, voidform(7), insanity_drain_stacks(4)
5:32.748 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity twist_of_fate, voidform(8), insanity_drain_stacks(5)
5:33.938 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, voidform(10), insanity_drain_stacks(7)
5:35.087 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity twist_of_fate, voidform(11), insanity_drain_stacks(8)
5:36.223 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.6/100: 72% insanity twist_of_fate, voidform(12), insanity_drain_stacks(9)
5:37.394 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, voidform(13), insanity_drain_stacks(10)
5:39.797 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.9/100: 51% insanity twist_of_fate, voidform(15), insanity_drain_stacks(12)
5:40.897 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.5/100: 51% insanity twist_of_fate, voidform(16), insanity_drain_stacks(13)
5:41.986 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.9/100: 46% insanity twist_of_fate, voidform(18), insanity_drain_stacks(15)
5:43.056 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.1/100: 67% insanity twist_of_fate, voidform(19), insanity_drain_stacks(16)
5:44.139 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity twist_of_fate, voidform(20), insanity_drain_stacks(17)
5:46.489 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.7/100: 33% insanity twist_of_fate, voidform(22), insanity_drain_stacks(19)
5:47.524 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.7/100: 31% insanity twist_of_fate, voidform(23), insanity_drain_stacks(20)
5:48.553 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.2/100: 27% insanity twist_of_fate, voidform(24), insanity_drain_stacks(21)
5:49.571 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.2/100: 16% insanity twist_of_fate, voidform(25), insanity_drain_stacks(22)
5:50.593 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.5/100: 12% insanity twist_of_fate, voidform(26), insanity_drain_stacks(23)
5:51.596 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.5/100: 26% insanity twist_of_fate, voidform(27), insanity_drain_stacks(24)
5:52.590 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity twist_of_fate, voidform(28), insanity_drain_stacks(25)
5:53.587 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.8/100: 8% insanity twist_of_fate, voidform(29), insanity_drain_stacks(26)
5:54.566 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.2/100: 17% insanity twist_of_fate, voidform(30), insanity_drain_stacks(27)
5:55.538 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(31)
6:02.062 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, lingering_insanity(31)
6:03.027 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(31)
6:03.992 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, lingering_insanity(31)
6:03.992 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, voidform, insanity_drain_stacks
6:06.720 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
6:07.945 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
6:10.631 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
6:10.631 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace
6:11.809 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace
6:12.977 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace
6:14.135 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
6:15.296 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:17.767 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace
6:18.873 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace
6:19.030 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity berserking, twist_of_fate, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace
6:19.977 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.8/100: 69% insanity berserking, twist_of_fate, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace
6:20.925 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.7/100: 57% insanity berserking, twist_of_fate, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace
6:21.863 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.5/100: 61% insanity berserking, twist_of_fate, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace
6:24.037 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity berserking, twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
6:24.947 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.8/100: 32% insanity berserking, twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
6:29.219 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.1/100: 31% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22), potion_of_deadly_grace
6:30.221 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.8/100: 28% insanity twist_of_fate, voidform(27), insanity_drain_stacks(23), potion_of_deadly_grace
6:31.216 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.8/100: 28% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24), potion_of_deadly_grace
6:32.203 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.6/100: 42% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25), potion_of_deadly_grace
6:33.196 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.6/100: 41% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26), potion_of_deadly_grace
6:35.419 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.9/100: 5% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28), potion_of_deadly_grace
6:36.376 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.6/100: 4% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29)
6:37.325 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.8/100: 12% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30)
6:38.266 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(34)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 31318 31318 19624
Intellect 30463 28757 20064 (729)
Spirit 1 1 0
Health 1879080 1879080 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 30463 28757 0
Crit 28.65% 28.65% 8277
Haste 19.23% 18.07% 5874
Damage / Heal Versatility 3.68% 3.68% 1472
ManaReg per Second 8800 8800 0
Mastery 55.13% 55.13% 4917
Armor 1623 1623 1623
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 854.00
Local Head Mitre of the High Priest
ilevel: 840, stats: { 204 Armor, +1772 Sta, +1182 Int, +817 Mastery, +440 Crit }
Local Neck An'she's Pendant
ilevel: 835, stats: { +952 Sta, +1141 Haste, +595 Crit }
Local Shoulders Roggthread Mantle
ilevel: 845, stats: { 192 Armor, +929 Int, +1393 Sta, +666 Haste, +295 Vers }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Bonespeaker Cinch
ilevel: 830, stats: { 136 Armor, +807 Int, +1211 Sta, +551 Crit, +356 Mastery }
Local Legs Legwraps of Rampant Turmoil
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +777 Crit, +503 Haste }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Gloves of the High Priest
ilevel: 840, stats: { 157 Armor, +1329 Sta, +886 Int, +572 Haste, +370 Vers }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +430 Mastery, +304 Crit }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 878, weapon: { 1480 - 2751, 1.8 }, stats: { +722 Int, +1082 Sta, +315 Crit, +303 Mastery, +9183 Int }, relics: { +45 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Secrets of the Void
ilevel: 878, stats: { +947 Int, +1421 Sta, +564 Haste, +250 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=755/enchanting=714
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!0101120
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:2:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=mitre_of_the_high_priest,id=139757,bonus_id=3385/3384
neck=anshes_pendant,id=139101,bonus_id=3432/1497/1674
shoulders=roggthread_mantle,id=134177,bonus_id=1727/1507/3336
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/1472
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=gloves_of_the_high_priest,id=139756,bonus_id=3386/3384
waist=bonespeaker_cinch,id=134215,bonus_id=3397/1492/1675
legs=legwraps_of_rampant_turmoil,id=137453,bonus_id=1727/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/137377/0,relic_id=1727:1507:3337/1807:1472/1727:1492:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=853.81
# gear_stamina=19624
# gear_intellect=20064
# gear_crit_rating=8277
# gear_haste_rating=5874
# gear_mastery_rating=4917
# gear_versatility_rating=1472
# gear_armor=1623
# set_bonus=tier19oh_2pc=1

Vait

Vait : 291375 dps

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
291375.0 291375.0 11201.2 / 3.844% 44879.4 / 15.4% 10048.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.0 29.0 Energy 10.95% 63.3 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 291375
Ambush 2703 0.9% 7.0 52.82sec 152066 151395 Direct 7.0 111927 222481 153233 36.5% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 1.0045 0.0000 1064460.10 1564857.17 31.98 151395.26 151395.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.44 63.49% 111926.90 103906 114297 111646.81 109101 114297 496440 729814 31.98
crit 2.56 36.51% 222481.26 207812 228593 221858.73 207812 228593 568020 835043 31.98
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 20681 7.1% 253.3 1.51sec 32301 22057 Direct 253.3 27060 54103 32537 37.3% 18.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 253.33 253.33 0.00 0.00 1.4644 0.0000 8182842.01 12029552.86 31.98 22056.89 22056.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.22 44.69% 27059.94 24648 27113 27065.23 27023 27113 3064287 4504792 31.98
crit 94.56 37.32% 54102.92 49296 54225 54125.22 53878 54225 5118555 7524761 31.98
miss 45.56 17.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 10166 3.5% 247.7 1.55sec 16230 10843 Direct 247.7 13536 27064 16241 38.9% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 247.67 247.67 0.00 0.00 1.4967 0.0000 4019531.18 5909091.58 31.98 10843.32 10843.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.22 42.08% 13535.75 12324 13556 13541.18 13513 13556 1411231 2074644 31.98
crit 96.33 38.90% 27063.67 24648 27113 27078.06 27013 27113 2608300 3834448 31.98
miss 47.11 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ghostly Strike 3978 1.4% 27.2 14.84sec 58207 60763 Direct 27.2 43824 87954 59158 32.2% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.22 27.22 129.67 0.00 0.9579 2.9891 1584511.50 2329382.00 31.98 3830.41 60762.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.44 67.76% 43824.43 40640 44704 43888.46 43509 44150 809641 1190248 31.98
crit 8.78 32.24% 87954.38 81280 89408 87975.21 83989 89408 774871 1139134 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 11863 (18056) 4.1% (6.2%) 39.4 11.64sec 181585 0 Direct 39.4 88848 177701 119777 34.4% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.44 39.44 0.00 0.00 0.0000 0.0000 4709767.71 6923804.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.89 65.63% 88847.54 80816 88897 88839.25 88619 88897 2299660 3380718 31.98
crit 13.56 34.37% 177701.42 161632 177795 177794.85 177795 177795 2410108 3543087 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 6193 2.1% 39.4 11.64sec 62183 0 Direct 39.4 44435 88818 62563 40.0% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.44 39.44 0.00 0.00 0.0000 0.0000 2452760.82 3605790.74 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.67 60.00% 44434.97 40408 44449 44448.71 44449 44449 1051953 1546470 31.98
crit 15.78 40.00% 88817.81 80816 88897 88794.80 88359 88897 1400808 2059320 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 24470 8.4% 240.3 1.59sec 40370 0 Direct 240.3 29298 58590 40170 37.8% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 240.33 240.33 0.00 0.00 0.0000 0.0000 9702271.58 14263258.25 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.56 62.23% 29297.98 26671 29338 29299.66 29255 29338 4381728 6441556 31.98
crit 90.78 37.77% 58590.11 53342 58676 58601.31 58409 58676 5320543 7821702 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 7986 2.8% 43.9 8.53sec 72607 74577 Direct 43.9 44962 89859 71008 61.5% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.89 43.89 0.00 0.00 0.9736 0.0000 3186662.02 4684695.02 31.98 74576.69 74576.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.89 38.48% 44961.58 40890 44979 44978.55 44979 44979 759638 1116739 31.98
crit 27.00 61.52% 89858.86 81779 89957 89892.51 89616 89957 2427024 3567956 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 12613 4.2% 26.1 5.49sec 186011 0 Direct 26.1 132625 264507 186165 40.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.11 26.11 0.00 0.00 0.0000 0.0000 4856954.95 7140183.84 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.56 59.57% 132624.53 121121 133233 132605.34 131887 133233 2063096 3032946 31.98
crit 10.56 40.43% 264507.05 242242 266466 264943.17 260410 266466 2793859 4107238 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 125504 43.1% 104.6 3.80sec 475840 503886 Direct 104.6 347469 690406 476865 37.4% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.56 104.56 0.00 0.00 0.9443 0.0000 49751701.61 73139713.98 31.98 503886.14 503886.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.44 62.59% 347469.46 258656 387984 347796.47 334155 368452 22741378 33431980 31.98
crit 39.11 37.41% 690405.98 517514 775969 691840.29 672693 715968 27010324 39707734 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 62536 21.5% 223.1 1.78sec 111338 172746 Direct 223.1 80225 160503 110312 38.7% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.11 223.11 0.00 0.00 0.6445 0.0000 24840763.20 36518274.88 31.98 172746.43 172746.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.67 61.25% 80224.59 73023 80325 80256.69 80118 80325 10968038 16124054 31.98
crit 86.44 38.75% 160502.69 146046 160650 160490.77 160142 160650 13872726 20394221 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing $sw1 Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2682 0.9% 24.2 16.78sec 43935 0 Direct 24.2 43905 0 43905 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.22 24.22 0.00 0.00 0.0000 0.0000 1064197.42 1064197.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.22 100.00% 43904.83 40074 44082 43935.27 43718 44082 1064197 1064197 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.8 64.07sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Curse of the Dreadblades 4.7 91.69sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 20.8 16.82sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.78 0.00 0.00 0.00 1.0046 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 15.4 22.80sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 14.7 28.62sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.8997 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 15.7 23.12sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.67 0.00 493.11 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.0 52.72sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.8 0.0 68.9sec 68.9sec 21.68% 22.17% 0.0(0.0) 5.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 118.2 0.0sec 3.4sec 100.00% 99.64% 102.4(118.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.60%
  • alacrity_2:0.27%
  • alacrity_3:0.33%
  • alacrity_4:0.27%
  • alacrity_5:0.28%
  • alacrity_6:0.31%
  • alacrity_7:0.37%
  • alacrity_8:0.34%
  • alacrity_9:0.32%
  • alacrity_10:0.36%
  • alacrity_11:0.27%
  • alacrity_12:0.53%
  • alacrity_13:0.63%
  • alacrity_14:0.83%
  • alacrity_15:0.93%
  • alacrity_16:0.87%
  • alacrity_17:0.91%
  • alacrity_18:0.78%
  • alacrity_19:1.30%
  • alacrity_20:89.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Frenzy 13.2 9.9 29.1sec 16.1sec 44.27% 64.86% 9.9(9.9) 13.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:44.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 23.68% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 71.6sec 68.0sec 28.35% 28.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:28.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.2 0.0 88.5sec 86.0sec 25.06% 25.26% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:25.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.7 0.0 91.5sec 91.5sec 14.11% 16.89% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 2.8 0.0 82.2sec 78.9sec 25.61% 34.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:25.61%

Trigger Attempt Success

  • trigger_pct:88.89%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 59.2sec 64.8sec 4.22% 9.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 3.9 0.0 73.2sec 72.7sec 24.94% 34.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:24.94%

Trigger Attempt Success

  • trigger_pct:88.89%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 44.8 20.3 8.8sec 6.1sec 39.10% 56.73% 20.3(20.3) 0.8

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:39.10%

Trigger Attempt Success

  • trigger_pct:42.44%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing $sw1 Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 119.2sec 0.0sec 12.30% 50.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 5.40% 28.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:5.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 3.0 11.7 122.8sec 26.0sec 99.22% 99.55% 11.7(11.7) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:99.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.4 0.0 74.5sec 71.0sec 36.12% 57.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:36.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 15.2 0.4 27.3sec 26.3sec 31.39% 37.32% 493.1(493.1) 14.8

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:31.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Stealth 1.1 0.0 85.9sec 0.0sec 0.08% 0.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 76.2sec 72.9sec 42.99% 53.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:42.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.0 0.0 64.8sec 64.8sec 0.13% 0.13% 0.0(0.0) 0.1

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 420.0 60.0 60.0 2534.4
ghostly_strike Energy 27.2 816.9 30.0 30.0 1939.6
roll_the_bones Energy 15.5 188.0 12.2 12.8 0.0
roll_the_bones Combo Points 15.5 85.2 5.5 5.8 0.0
run_through Energy 103.8 2386.7 23.0 22.8 20845.5
run_through Combo Points 103.8 598.1 5.8 5.7 83186.1
saber_slash Energy 223.3 7700.0 34.5 34.5 3226.1
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 15.23 73.15 (10.66%) 4.80 3.00 3.94%
gouge Combo Points 20.85 20.85 (3.04%) 1.00 0.00 0.00%
ghostly_strike Combo Points 27.23 27.23 (3.97%) 1.00 0.00 0.00%
pistol_shot Combo Points 44.15 44.15 (6.43%) 1.00 0.00 0.00%
saber_slash Combo Points 223.31 206.23 (30.05%) 0.92 17.08 7.65%
adrenaline_rush Energy 296.08 1381.71 (12.06%) 4.67 184.84 11.80%
ambush Combo Points 7.00 14.00 (2.04%) 2.00 0.00 0.00%
energy_regen Energy 1360.69 7060.19 (61.64%) 5.19 286.82 3.90%
combat_potency Energy 190.85 3011.87 (26.30%) 15.78 41.67 1.36%
Broadsides Combo Points 73.00 64.77 (9.44%) 0.89 8.23 11.28%
Ruthlessness Combo Points 119.15 137.08 (19.97%) 1.15 0.00 0.00%
Curse of the Dreadblades Combo Points 28.92 98.85 (14.40%) 3.42 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.82 28.96
Combo Points 1.73 1.72
Combat End Resource Mean Min Max
Energy 45.33 17.06 73.59
Combo Points 5.00 5.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.1%

Procs

Count Interval
Roll the Bones: 1 buff 8.2 40.2sec
Roll the Bones: 2 buffs 5.7 63.0sec
Roll the Bones: 3 buffs 0.6 44.8sec
Roll the Bones: 6 buffs 0.2 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Vait Damage Per Second
Count 9
Mean 291374.95
Minimum 271207.98
Maximum 323332.64
Spread ( max - min ) 52124.66
Range [ ( max - min ) / 2 * 100% ] 8.94%
Standard Deviation 17145.0460
5th Percentile 271207.98
95th Percentile 316087.36
( 95th Percentile - 5th Percentile ) 44879.39
Mean Distribution
Standard Deviation 5715.0153
95.00% Confidence Intervall ( 280173.73 - 302576.18 )
Normalized 95.00% Confidence Intervall ( 96.16% - 103.84% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 133
0.1% Error 13300
0.1 Scale Factor Error with Delta=300 2509348
0.05 Scale Factor Error with Delta=300 10037393
0.01 Scale Factor Error with Delta=300 250934849
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9
Mean 291374.95
Minimum 271207.98
Maximum 323332.64
Spread ( max - min ) 52124.66
Range [ ( max - min ) / 2 * 100% ] 8.94%
Standard Deviation 17145.0460
5th Percentile 271207.98
95th Percentile 316087.36
( 95th Percentile - 5th Percentile ) 44879.39
Mean Distribution
Standard Deviation 5715.0153
95.00% Confidence Intervall ( 280173.73 - 302576.18 )
Normalized 95.00% Confidence Intervall ( 96.16% - 103.84% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 133
0.1% Error 13300
0.1 Scale Factor Error with Delta=300 2509348
0.05 Scale Factor Error with Delta=300 10037393
0.01 Scale Factor Error with Delta=300 250934849
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9
Mean 291374.95
Minimum 271207.98
Maximum 323332.64
Spread ( max - min ) 52124.66
Range [ ( max - min ) / 2 * 100% ] 8.94%
Damage
Sample Data Vait Damage
Count 9
Mean 115416424.11
Minimum 94466109.22
Maximum 138029661.84
Spread ( max - min ) 43563552.63
Range [ ( max - min ) / 2 * 100% ] 18.87%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 14.46 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 20.85 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.build Builders
# count action,conditions
F 27.23 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
G 44.15 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
H 154.00 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
I 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
J 5.77 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
K 14.23 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
L 15.38 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
M 4.77 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
N 103.77 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
O 7.00 ambush
P 6.00 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

0124567OJFHLBMHBHNHNHNHNHNHNHNHFHNHHGNHHHHNHFHGNHHHNGHGNHFHNGHEHNHGHBKNHFLNGHNEHNGHNHNGFNHNGHNGENHNGFNHNMGNHNGBHNHNGNHFGNHGENHHGNHKNEHFLGNHHGNHFGNEHGBPOHHNGHHFHNEHHHHNEHFHNGHHHENHHFHJIBKBHMHLBHNHNHNHNKLNHNHNPOFGHNGEHHHLNKNGFHHNJGHHGNHHGHLNKNHFHGNPOHENHHGHLBFGEHBGHNGHNKNGHNHENHNGFNHNGHNEHNHFNMHNEHNGNHNHFNEHNGHLBFHGHBHEHHBKNJHGFNHHEHNHHLNHHGNKNHHGFNHGHNGHEHLNKNGHHFNEHHHNGHEFLBJKNMHNHNHNHLNKNHNHNGNPOFHLNKNHGHENHGHHNJHFGLBKNHNHGNHH

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points stealth, potion_of_the_old_war
Pre roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:01.005 adrenaline_rush Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points bloodlust, alacrity, roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.005 ghostly_strike Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.809 saber_slash Fluffy_Pillow 89.3/100: 89% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
0:02.612 sprint Fluffy_Pillow 94.2/100: 94% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:02.612 roll_the_bones Fluffy_Pillow 94.2/100: 94% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, sprint, alacrity, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:03.415 curse_of_the_dreadblades Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity(2), broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:03.415 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity(2), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:04.217 roll_the_bones Fluffy_Pillow 81.4/100: 81% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.021 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.826 run_through Fluffy_Pillow 97.8/100: 98% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:06.630 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:07.436 run_through Fluffy_Pillow 98.5/100: 98% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:08.242 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.048 run_through Fluffy_Pillow 98.8/100: 99% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.852 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(7), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:10.657 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:11.462 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:12.268 run_through Fluffy_Pillow 96.9/100: 97% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.074 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.881 run_through Fluffy_Pillow 81.3/100: 81% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:14.684 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), jolly_roger, grand_melee, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:15.489 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), jolly_roger, grand_melee, roll_the_bones, potion_of_the_old_war
0:16.294 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(12), jolly_roger, grand_melee, roll_the_bones, potion_of_the_old_war
0:17.298 ghostly_strike Fluffy_Pillow 86.0/100: 86% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(12), jolly_roger, grand_melee, roll_the_bones, potion_of_the_old_war
0:18.302 saber_slash Fluffy_Pillow 92.0/100: 92% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(12), jolly_roger, grand_melee, roll_the_bones, potion_of_the_old_war
0:19.306 run_through Fluffy_Pillow 62.0/100: 62% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(12), jolly_roger, grand_melee, roll_the_bones, potion_of_the_old_war
0:20.311 saber_slash Fluffy_Pillow 59.1/100: 59% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(13), jolly_roger, grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:21.315 saber_slash Fluffy_Pillow 62.9/100: 63% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(13), jolly_roger, grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:22.322 pistol_shot Fluffy_Pillow 50.8/100: 51% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(13), jolly_roger, grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:23.325 run_through Fluffy_Pillow 72.5/100: 73% energy | 6.0/6: 100% combo_points bloodlust, alacrity(13), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:24.328 saber_slash Fluffy_Pillow 87.5/100: 87% energy | 1.0/6: 17% combo_points bloodlust, alacrity(14), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:25.332 saber_slash Fluffy_Pillow 91.4/100: 91% energy | 2.0/6: 33% combo_points bloodlust, alacrity(14), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:26.337 saber_slash Fluffy_Pillow 63.4/100: 63% energy | 3.0/6: 50% combo_points bloodlust, alacrity(14), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:27.341 saber_slash Fluffy_Pillow 67.4/100: 67% energy | 4.0/6: 67% combo_points bloodlust, alacrity(14), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:28.346 run_through Fluffy_Pillow 87.4/100: 87% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(14), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:29.351 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(16), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:30.355 ghostly_strike Fluffy_Pillow 72.3/100: 72% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(16), jolly_roger, grand_melee, roll_the_bones
0:31.359 saber_slash Fluffy_Pillow 79.0/100: 79% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(16), jolly_roger, grand_melee, roll_the_bones
0:32.365 pistol_shot Fluffy_Pillow 49.7/100: 50% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(16), jolly_roger, grand_melee, roll_the_bones
0:33.370 run_through Fluffy_Pillow 86.4/100: 86% energy | 6.0/6: 100% combo_points bloodlust, alacrity(16), jolly_roger, grand_melee, roll_the_bones
0:34.375 saber_slash Fluffy_Pillow 84.3/100: 84% energy | 2.0/6: 33% combo_points bloodlust, alacrity(17), jolly_roger, grand_melee, roll_the_bones
0:35.379 saber_slash Fluffy_Pillow 71.2/100: 71% energy | 3.0/6: 50% combo_points bloodlust, alacrity(17), jolly_roger, grand_melee, roll_the_bones
0:36.384 saber_slash Fluffy_Pillow 58.1/100: 58% energy | 4.0/6: 67% combo_points bloodlust, alacrity(17), jolly_roger, grand_melee, roll_the_bones
0:37.388 run_through Fluffy_Pillow 29.0/100: 29% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(17), jolly_roger, grand_melee, roll_the_bones
0:38.392 pistol_shot Fluffy_Pillow 43.0/100: 43% energy | 2.0/6: 33% combo_points bloodlust, opportunity, alacrity(18), jolly_roger, grand_melee, roll_the_bones
0:39.397 saber_slash Fluffy_Pillow 80.1/100: 80% energy | 3.0/6: 50% combo_points bloodlust, alacrity(18), jolly_roger, grand_melee, roll_the_bones
0:40.401 pistol_shot Fluffy_Pillow 51.1/100: 51% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, opportunity, alacrity(18), jolly_roger, grand_melee, roll_the_bones
0:41.405 Waiting 4.900 sec 69.7/100: 70% energy | 6.0/6: 100% combo_points raid_movement, alacrity(18), jolly_roger, grand_melee, roll_the_bones
0:46.305 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(18), jolly_roger, grand_melee, roll_the_bones
0:47.311 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points alacrity(19), jolly_roger, grand_melee, roll_the_bones
0:48.315 ghostly_strike Fluffy_Pillow 82.3/100: 82% energy | 3.0/6: 50% combo_points alacrity(19), jolly_roger, grand_melee, roll_the_bones
0:49.317 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points alacrity(19), jolly_roger, grand_melee, roll_the_bones
0:50.321 run_through Fluffy_Pillow 67.0/100: 67% energy | 6.0/6: 100% combo_points opportunity, alacrity(19), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:51.326 pistol_shot Fluffy_Pillow 61.8/100: 62% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:52.331 saber_slash Fluffy_Pillow 79.6/100: 80% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:53.335 gouge Fluffy_Pillow 47.4/100: 47% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:54.340 saber_slash Fluffy_Pillow 65.2/100: 65% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:55.344 run_through Fluffy_Pillow 33.0/100: 33% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:56.347 Waiting 0.400 sec 43.7/100: 44% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:56.747 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:57.751 pistol_shot Fluffy_Pillow 34.6/100: 35% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:58.756 saber_slash Fluffy_Pillow 68.4/100: 68% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
0:59.759 roll_the_bones Fluffy_Pillow 68.2/100: 68% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), blood_frenzy
1:00.762 marked_for_death Fluffy_Pillow 73.0/100: 73% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:00.762 run_through Fluffy_Pillow 73.0/100: 73% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:01.768 saber_slash Fluffy_Pillow 83.8/100: 84% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:02.773 ghostly_strike Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:03.777 sprint Fluffy_Pillow 55.4/100: 55% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:03.777 run_through Fluffy_Pillow 55.4/100: 55% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:04.782 pistol_shot Fluffy_Pillow 50.2/100: 50% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:05.787 saber_slash Fluffy_Pillow 68.0/100: 68% energy | 3.0/6: 50% combo_points sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:06.793 run_through Fluffy_Pillow 51.8/100: 52% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:07.798 gouge Fluffy_Pillow 46.6/100: 47% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:08.803 saber_slash Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:09.808 run_through Fluffy_Pillow 32.2/100: 32% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:10.813 pistol_shot Fluffy_Pillow 42.4/100: 42% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, broadsides, roll_the_bones
1:11.817 saber_slash Fluffy_Pillow 58.9/100: 59% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:12.821 run_through Fluffy_Pillow 41.3/100: 41% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:13.825 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:14.829 run_through Fluffy_Pillow 49.3/100: 49% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones
1:15.833 pistol_shot Fluffy_Pillow 58.7/100: 59% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones
1:16.838 ghostly_strike Fluffy_Pillow 91.2/100: 91% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:17.842 run_through Fluffy_Pillow 77.7/100: 78% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:18.847 saber_slash Fluffy_Pillow 87.2/100: 87% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
1:19.850 run_through Fluffy_Pillow 54.3/100: 54% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:20.856 pistol_shot Fluffy_Pillow 49.1/100: 49% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:21.860 saber_slash Fluffy_Pillow 66.9/100: 67% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:22.864 run_through Fluffy_Pillow 34.7/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:23.868 pistol_shot Fluffy_Pillow 29.5/100: 29% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:24.872 gouge Fluffy_Pillow 47.3/100: 47% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:25.878 run_through Fluffy_Pillow 81.1/100: 81% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:26.881 saber_slash Fluffy_Pillow 75.8/100: 76% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:27.886 run_through Fluffy_Pillow 59.6/100: 60% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:28.889 pistol_shot Fluffy_Pillow 54.4/100: 54% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:29.893 ghostly_strike Fluffy_Pillow 72.2/100: 72% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:30.896 run_through Fluffy_Pillow 60.0/100: 60% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:31.901 saber_slash Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:32.906 run_through Fluffy_Pillow 54.6/100: 55% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:33.911 curse_of_the_dreadblades Fluffy_Pillow 49.4/100: 49% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
1:33.911 pistol_shot Fluffy_Pillow 49.4/100: 49% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:34.915 run_through Fluffy_Pillow 67.2/100: 67% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:35.919 saber_slash Fluffy_Pillow 78.0/100: 78% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:36.925 run_through Fluffy_Pillow 45.8/100: 46% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:37.929 pistol_shot Fluffy_Pillow 40.6/100: 41% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:38.932 roll_the_bones Fluffy_Pillow 74.3/100: 74% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, curse_of_the_dreadblades
1:39.936 saber_slash Fluffy_Pillow 77.7/100: 78% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:40.941 run_through Fluffy_Pillow 60.2/100: 60% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:41.945 saber_slash Fluffy_Pillow 53.7/100: 54% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:42.950 run_through Fluffy_Pillow 36.2/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:43.955 pistol_shot Fluffy_Pillow 29.7/100: 30% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:44.961 run_through Fluffy_Pillow 62.2/100: 62% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:45.968 saber_slash Fluffy_Pillow 55.7/100: 56% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:46.972 ghostly_strike Fluffy_Pillow 38.2/100: 38% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:47.976 pistol_shot Fluffy_Pillow 24.6/100: 25% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:48.981 run_through Fluffy_Pillow 57.1/100: 57% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:49.986 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:50.990 pistol_shot Fluffy_Pillow 33.1/100: 33% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:51.996 gouge Fluffy_Pillow 49.6/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:53.001 run_through Fluffy_Pillow 66.1/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:54.006 saber_slash Fluffy_Pillow 59.6/100: 60% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:55.009 Waiting 0.400 sec 43.3/100: 43% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:55.409 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:56.413 pistol_shot Fluffy_Pillow 18.2/100: 18% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:57.417 run_through Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:58.422 Waiting 1.100 sec 30.8/100: 31% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:59.522 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:00.525 marked_for_death Fluffy_Pillow 18.0/100: 18% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:00.762 Waiting 0.156 sec 22.2/100: 22% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:00.918 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:01.923 gouge Fluffy_Pillow 35.8/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:03.000 saber_slash Fluffy_Pillow 54.9/100: 55% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:04.002 ghostly_strike Fluffy_Pillow 38.6/100: 39% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:05.005 sprint Fluffy_Pillow 41.1/100: 41% energy | 5.0/6: 83% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:05.005 pistol_shot Fluffy_Pillow 41.1/100: 41% energy | 5.0/6: 83% combo_points raid_movement, opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:06.009 Waiting 2.900 sec 73.6/100: 74% energy | 6.0/6: 100% combo_points raid_movement, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:08.909 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:09.913 saber_slash Fluffy_Pillow 93.5/100: 93% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:10.918 saber_slash Fluffy_Pillow 76.0/100: 76% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:11.922 pistol_shot Fluffy_Pillow 58.4/100: 58% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:12.925 run_through Fluffy_Pillow 74.9/100: 75% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:13.929 saber_slash Fluffy_Pillow 68.4/100: 68% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:14.933 ghostly_strike Fluffy_Pillow 34.8/100: 35% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:15.936 pistol_shot Fluffy_Pillow 37.3/100: 37% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:16.939 run_through Fluffy_Pillow 53.7/100: 54% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:17.943 gouge Fluffy_Pillow 47.2/100: 47% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:18.949 saber_slash Fluffy_Pillow 63.7/100: 64% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:19.953 pistol_shot Fluffy_Pillow 46.2/100: 46% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:20.960 roll_the_bones Fluffy_Pillow 62.7/100: 63% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:21.963 vanish Fluffy_Pillow 70.3/100: 70% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:21.963 ambush Fluffy_Pillow 70.3/100: 70% energy | 1.0/6: 17% combo_points vanish, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:22.967 saber_slash Fluffy_Pillow 62.8/100: 63% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, hidden_blade
2:23.971 Waiting 0.900 sec 33.4/100: 33% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:24.871 saber_slash Fluffy_Pillow 51.9/100: 52% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:25.875 run_through Fluffy_Pillow 38.5/100: 38% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:26.880 pistol_shot Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:27.885 saber_slash Fluffy_Pillow 72.7/100: 73% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:28.890 saber_slash Fluffy_Pillow 75.3/100: 75% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:29.895 ghostly_strike Fluffy_Pillow 45.9/100: 46% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:30.899 saber_slash Fluffy_Pillow 52.5/100: 52% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:31.904 run_through Fluffy_Pillow 39.1/100: 39% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:32.908 gouge Fluffy_Pillow 36.7/100: 37% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:33.912 saber_slash Fluffy_Pillow 57.3/100: 57% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:34.916 Waiting 1.100 sec 27.9/100: 28% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:36.016 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:37.021 Waiting 0.700 sec 37.0/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:37.721 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:38.725 Waiting 1.447 sec 22.0/100: 22% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:40.172 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:41.177 Waiting 0.134 sec 22.3/100: 22% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:41.311 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:42.317 Waiting 0.415 sec 22.6/100: 23% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:42.732 gouge Fluffy_Pillow 31.1/100: 31% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:43.913 saber_slash Fluffy_Pillow 55.4/100: 55% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:44.917 Waiting 0.200 sec 25.9/100: 26% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:45.117 ghostly_strike Fluffy_Pillow 30.0/100: 30% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:46.123 Waiting 0.700 sec 36.7/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:46.823 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:47.828 run_through Fluffy_Pillow 37.6/100: 38% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones
2:48.832 pistol_shot Fluffy_Pillow 35.6/100: 36% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:49.837 saber_slash Fluffy_Pillow 57.9/100: 58% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:50.841 Waiting 0.400 sec 30.1/100: 30% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:51.241 saber_slash Fluffy_Pillow 55.0/100: 55% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:52.246 Waiting 0.400 sec 43.2/100: 43% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:52.646 saber_slash Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:53.653 gouge Fluffy_Pillow 24.4/100: 24% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:54.657 run_through Fluffy_Pillow 46.6/100: 47% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:55.659 Waiting 0.200 sec 45.8/100: 46% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:55.859 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:56.864 Waiting 1.312 sec 22.5/100: 22% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:58.176 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:59.180 Waiting 0.400 sec 39.8/100: 40% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
2:59.580 ghostly_strike Fluffy_Pillow 48.6/100: 49% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:00.585 saber_slash Fluffy_Pillow 52.4/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), blood_frenzy
3:01.590 adrenaline_rush Fluffy_Pillow 20.2/100: 20% energy | 5.0/6: 83% combo_points alacrity(20), blood_frenzy
3:01.590 potion Fluffy_Pillow 20.2/100: 20% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), blood_frenzy
3:01.590 roll_the_bones Fluffy_Pillow 20.2/100: 20% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), blood_frenzy, potion_of_the_old_war
3:02.396 marked_for_death Fluffy_Pillow 58.9/100: 59% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:02.396 roll_the_bones Fluffy_Pillow 58.9/100: 59% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:03.200 saber_slash Fluffy_Pillow 74.4/100: 74% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:04.005 curse_of_the_dreadblades Fluffy_Pillow 53.0/100: 53% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:04.005 saber_slash Fluffy_Pillow 53.0/100: 53% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:04.810 sprint Fluffy_Pillow 47.5/100: 47% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:05.005 roll_the_bones Fluffy_Pillow 54.4/100: 54% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:05.807 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:06.611 run_through Fluffy_Pillow 64.3/100: 64% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:07.415 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:08.221 run_through Fluffy_Pillow 64.3/100: 64% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:09.025 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:09.830 run_through Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:10.635 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:11.439 run_through Fluffy_Pillow 78.5/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:12.244 marked_for_death Fluffy_Pillow 84.0/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:12.244 sprint Fluffy_Pillow 84.0/100: 84% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:12.244 run_through Fluffy_Pillow 84.0/100: 84% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:13.050 saber_slash Fluffy_Pillow 89.6/100: 90% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:13.857 run_through Fluffy_Pillow 84.2/100: 84% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:14.664 saber_slash Fluffy_Pillow 89.7/100: 90% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:15.469 run_through Fluffy_Pillow 68.3/100: 68% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:16.273 vanish Fluffy_Pillow 72.5/100: 73% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:16.273 ambush Fluffy_Pillow 72.5/100: 73% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, sprint, alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:17.276 ghostly_strike Fluffy_Pillow 34.2/100: 34% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
3:18.279 pistol_shot Fluffy_Pillow 20.6/100: 21% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
3:19.282 saber_slash Fluffy_Pillow 53.1/100: 53% energy | 5.0/6: 83% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
3:20.287 run_through Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:21.292 pistol_shot Fluffy_Pillow 29.1/100: 29% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:22.297 gouge Fluffy_Pillow 45.6/100: 46% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:23.303 saber_slash Fluffy_Pillow 78.1/100: 78% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:24.308 Waiting 0.400 sec 44.5/100: 45% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:24.708 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, potion_of_the_old_war
3:25.713 Waiting 0.943 sec 18.9/100: 19% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:26.656 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:27.662 sprint Fluffy_Pillow 51.4/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:27.662 run_through Fluffy_Pillow 51.4/100: 51% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:28.666 marked_for_death Fluffy_Pillow 46.2/100: 46% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:28.666 run_through Fluffy_Pillow 46.2/100: 46% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:29.671 pistol_shot Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:30.675 Waiting 3.200 sec 58.8/100: 59% energy | 3.0/6: 50% combo_points raid_movement, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:33.875 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:34.880 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:35.885 saber_slash Fluffy_Pillow 67.8/100: 68% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:36.890 run_through Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:37.893 adrenaline_rush Fluffy_Pillow 46.4/100: 46% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:37.893 pistol_shot Fluffy_Pillow 46.4/100: 46% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:38.697 saber_slash Fluffy_Pillow 74.9/100: 75% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:39.502 saber_slash Fluffy_Pillow 53.4/100: 53% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:40.308 pistol_shot Fluffy_Pillow 31.9/100: 32% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:41.114 run_through Fluffy_Pillow 60.5/100: 60% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:41.918 saber_slash Fluffy_Pillow 82.0/100: 82% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:42.723 saber_slash Fluffy_Pillow 76.5/100: 77% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:43.528 pistol_shot Fluffy_Pillow 55.0/100: 55% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:44.332 saber_slash Fluffy_Pillow 82.3/100: 82% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
3:45.135 sprint Fluffy_Pillow 58.7/100: 59% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
3:45.135 run_through Fluffy_Pillow 58.7/100: 59% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones
3:45.938 marked_for_death Fluffy_Pillow 62.0/100: 62% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones
3:45.938 run_through Fluffy_Pillow 62.0/100: 62% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones
3:46.742 saber_slash Fluffy_Pillow 65.4/100: 65% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones
3:47.546 ghostly_strike Fluffy_Pillow 75.9/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:48.351 saber_slash Fluffy_Pillow 74.4/100: 74% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:49.154 pistol_shot Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:49.958 run_through Fluffy_Pillow 81.3/100: 81% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:50.763 vanish Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:50.763 ambush Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points adrenaline_rush, vanish, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:51.768 saber_slash Fluffy_Pillow 62.5/100: 62% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
3:52.574 gouge Fluffy_Pillow 41.0/100: 41% energy | 5.0/6: 83% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:53.577 run_through Fluffy_Pillow 80.4/100: 80% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:54.581 saber_slash Fluffy_Pillow 75.2/100: 75% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:55.586 Waiting 0.400 sec 43.0/100: 43% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:55.986 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:56.990 pistol_shot Fluffy_Pillow 49.6/100: 50% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
3:57.994 saber_slash Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
3:59.001 sprint Fluffy_Pillow 32.6/100: 33% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
3:59.001 roll_the_bones Fluffy_Pillow 32.6/100: 33% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:00.006 ghostly_strike Fluffy_Pillow 36.0/100: 36% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:01.010 pistol_shot Fluffy_Pillow 22.5/100: 23% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:02.014 Waiting 0.400 sec 39.0/100: 39% energy | 3.0/6: 50% combo_points sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:02.414 gouge Fluffy_Pillow 45.5/100: 46% energy | 3.0/6: 50% combo_points sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:03.581 saber_slash Fluffy_Pillow 64.7/100: 65% energy | 4.0/6: 67% combo_points sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:04.586 roll_the_bones Fluffy_Pillow 31.2/100: 31% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, roll_the_bones
4:05.591 pistol_shot Fluffy_Pillow 34.7/100: 35% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:06.593 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:07.597 run_through Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:08.602 pistol_shot Fluffy_Pillow 43.1/100: 43% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:09.605 saber_slash Fluffy_Pillow 59.5/100: 60% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:10.608 run_through Fluffy_Pillow 42.0/100: 42% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:11.614 marked_for_death Fluffy_Pillow 51.5/100: 51% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:11.614 run_through Fluffy_Pillow 51.5/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:12.617 pistol_shot Fluffy_Pillow 44.9/100: 45% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:13.623 saber_slash Fluffy_Pillow 78.7/100: 79% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:14.627 run_through Fluffy_Pillow 46.5/100: 47% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:15.632 saber_slash Fluffy_Pillow 57.3/100: 57% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:16.636 gouge Fluffy_Pillow 25.1/100: 25% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:17.640 run_through Fluffy_Pillow 58.9/100: 59% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:18.644 saber_slash Fluffy_Pillow 53.7/100: 54% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:19.648 run_through Fluffy_Pillow 53.5/100: 53% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:20.653 pistol_shot Fluffy_Pillow 48.3/100: 48% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:21.658 ghostly_strike Fluffy_Pillow 82.1/100: 82% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:22.662 run_through Fluffy_Pillow 85.8/100: 86% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:23.666 saber_slash Fluffy_Pillow 79.3/100: 79% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:24.670 run_through Fluffy_Pillow 61.7/100: 62% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:25.674 pistol_shot Fluffy_Pillow 55.2/100: 55% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:26.680 saber_slash Fluffy_Pillow 87.7/100: 88% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:27.684 run_through Fluffy_Pillow 54.2/100: 54% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:28.689 gouge Fluffy_Pillow 47.7/100: 48% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:29.691 saber_slash Fluffy_Pillow 64.1/100: 64% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:30.696 run_through Fluffy_Pillow 62.6/100: 63% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:31.701 saber_slash Fluffy_Pillow 56.1/100: 56% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:32.704 ghostly_strike Fluffy_Pillow 38.5/100: 39% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:33.707 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:34.711 curse_of_the_dreadblades Fluffy_Pillow 18.5/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:34.711 Waiting 1.998 sec 18.5/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:36.709 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:37.714 Waiting 0.443 sec 17.7/100: 18% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:38.157 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:39.159 gouge Fluffy_Pillow 19.4/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.162 Waiting 0.800 sec 37.1/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.962 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:41.967 run_through Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:42.971 pistol_shot Fluffy_Pillow 29.9/100: 30% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:43.975 run_through Fluffy_Pillow 47.7/100: 48% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:44.980 saber_slash Fluffy_Pillow 58.5/100: 58% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:45.985 run_through Fluffy_Pillow 42.3/100: 42% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:46.990 saber_slash Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:47.994 ghostly_strike Fluffy_Pillow 36.9/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:48.998 run_through Fluffy_Pillow 24.7/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:50.002 gouge Fluffy_Pillow 19.4/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:51.005 Waiting 0.800 sec 37.2/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:51.805 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:52.808 Waiting 0.329 sec 19.2/100: 19% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:53.137 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:54.140 pistol_shot Fluffy_Pillow 19.8/100: 20% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:55.147 Waiting 6.100 sec 36.9/100: 37% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:01.247 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points alacrity(20)
5:02.250 sprint Fluffy_Pillow 83.8/100: 84% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), blood_frenzy
5:02.250 roll_the_bones Fluffy_Pillow 83.8/100: 84% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), blood_frenzy
5:03.253 ghostly_strike Fluffy_Pillow 88.5/100: 89% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
5:04.258 saber_slash Fluffy_Pillow 76.3/100: 76% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
5:05.264 pistol_shot Fluffy_Pillow 44.2/100: 44% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
5:06.268 saber_slash Fluffy_Pillow 77.9/100: 78% energy | 4.0/6: 67% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
5:07.274 roll_the_bones Fluffy_Pillow 45.8/100: 46% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
5:08.278 saber_slash Fluffy_Pillow 55.0/100: 55% energy | 1.0/6: 17% combo_points sprint, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
5:09.282 gouge Fluffy_Pillow 27.2/100: 27% energy | 2.0/6: 33% combo_points sprint, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
5:10.287 Waiting 0.100 sec 49.5/100: 49% energy | 3.0/6: 50% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
5:10.387 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
5:11.391 Waiting 1.300 sec 23.7/100: 24% energy | 4.0/6: 67% combo_points alacrity(20), buried_treasure, roll_the_bones
5:12.691 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), buried_treasure, roll_the_bones
5:13.695 roll_the_bones Fluffy_Pillow 36.9/100: 37% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones
5:14.698 marked_for_death Fluffy_Pillow 56.4/100: 56% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:14.698 run_through Fluffy_Pillow 56.4/100: 56% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:15.702 adrenaline_rush Fluffy_Pillow 49.9/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:15.893 saber_slash Fluffy_Pillow 53.0/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:16.696 pistol_shot Fluffy_Pillow 45.3/100: 45% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:17.501 ghostly_strike Fluffy_Pillow 71.8/100: 72% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:18.306 run_through Fluffy_Pillow 68.2/100: 68% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:19.110 saber_slash Fluffy_Pillow 71.5/100: 72% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:19.915 saber_slash Fluffy_Pillow 64.0/100: 64% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:20.718 gouge Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:21.720 saber_slash Fluffy_Pillow 89.2/100: 89% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:22.524 run_through Fluffy_Pillow 81.6/100: 82% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:23.328 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:24.132 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:24.938 sprint Fluffy_Pillow 68.8/100: 69% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:24.938 run_through Fluffy_Pillow 68.8/100: 69% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:25.743 saber_slash Fluffy_Pillow 72.2/100: 72% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:26.547 saber_slash Fluffy_Pillow 80.6/100: 81% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:27.351 pistol_shot Fluffy_Pillow 57.8/100: 58% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:28.156 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:28.961 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:28.961 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:29.766 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:30.570 saber_slash Fluffy_Pillow 78.5/100: 78% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:31.374 pistol_shot Fluffy_Pillow 48.5/100: 48% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:32.379 ghostly_strike Fluffy_Pillow 82.3/100: 82% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:33.382 run_through Fluffy_Pillow 86.0/100: 86% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:34.387 saber_slash Fluffy_Pillow 80.8/100: 81% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:35.390 pistol_shot Fluffy_Pillow 48.6/100: 49% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:36.395 saber_slash Fluffy_Pillow 66.4/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
5:37.400 run_through Fluffy_Pillow 33.7/100: 34% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:38.406 pistol_shot Fluffy_Pillow 43.2/100: 43% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:39.413 saber_slash Fluffy_Pillow 59.8/100: 60% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:40.418 gouge Fluffy_Pillow 26.2/100: 26% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:41.423 saber_slash Fluffy_Pillow 58.7/100: 59% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:42.429 sprint Fluffy_Pillow 25.2/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:42.429 run_through Fluffy_Pillow 25.2/100: 25% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:43.434 marked_for_death Fluffy_Pillow 34.7/100: 35% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:43.434 run_through Fluffy_Pillow 34.7/100: 35% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:44.438 pistol_shot Fluffy_Pillow 28.2/100: 28% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:45.442 saber_slash Fluffy_Pillow 60.7/100: 61% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:46.446 Waiting 0.600 sec 27.1/100: 27% energy | 3.0/6: 50% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:47.046 saber_slash Fluffy_Pillow 53.0/100: 53% energy | 3.0/6: 50% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:48.050 Waiting 0.738 sec 19.4/100: 19% energy | 4.0/6: 67% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:48.788 ghostly_strike Fluffy_Pillow 31.6/100: 32% energy | 4.0/6: 67% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:49.793 run_through Fluffy_Pillow 34.0/100: 34% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:50.798 gouge Fluffy_Pillow 43.5/100: 44% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:51.801 saber_slash Fluffy_Pillow 76.0/100: 76% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:52.805 saber_slash Fluffy_Pillow 58.5/100: 58% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:53.810 Waiting 1.600 sec 24.9/100: 25% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:55.410 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:56.414 Waiting 0.447 sec 17.7/100: 18% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:56.861 run_through Fluffy_Pillow 41.0/100: 41% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:57.864 pistol_shot Fluffy_Pillow 34.4/100: 34% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:58.870 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
5:59.875 Waiting 0.761 sec 17.4/100: 17% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
6:00.636 gouge Fluffy_Pillow 30.4/100: 30% energy | 3.0/6: 50% combo_points alacrity(20), blood_frenzy
6:01.803 ghostly_strike Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), blood_frenzy
6:02.807 sprint Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points alacrity(20), blood_frenzy
6:02.807 roll_the_bones Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points sprint, alacrity(20), blood_frenzy
6:03.811 adrenaline_rush Fluffy_Pillow 59.6/100: 60% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:03.811 marked_for_death Fluffy_Pillow 59.6/100: 60% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:03.811 run_through Fluffy_Pillow 59.6/100: 60% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:04.617 curse_of_the_dreadblades Fluffy_Pillow 65.2/100: 65% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:04.711 saber_slash Fluffy_Pillow 68.5/100: 69% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:05.516 run_through Fluffy_Pillow 63.0/100: 63% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:06.321 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:07.126 run_through Fluffy_Pillow 63.1/100: 63% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:07.930 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:08.735 run_through Fluffy_Pillow 47.1/100: 47% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:09.541 saber_slash Fluffy_Pillow 52.7/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:10.346 sprint Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:10.346 run_through Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:11.151 marked_for_death Fluffy_Pillow 52.5/100: 52% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:11.151 run_through Fluffy_Pillow 52.5/100: 52% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:11.956 saber_slash Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:12.761 run_through Fluffy_Pillow 52.5/100: 53% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:13.564 saber_slash Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:14.370 run_through Fluffy_Pillow 52.5/100: 53% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:15.175 pistol_shot Fluffy_Pillow 58.1/100: 58% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:15.979 run_through Fluffy_Pillow 86.6/100: 87% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:16.783 vanish Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:16.783 ambush Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points adrenaline_rush, vanish, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:17.787 ghostly_strike Fluffy_Pillow 67.6/100: 68% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
6:18.590 saber_slash Fluffy_Pillow 66.1/100: 66% energy | 4.0/6: 67% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
6:19.395 sprint Fluffy_Pillow 66.2/100: 66% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:19.395 run_through Fluffy_Pillow 66.2/100: 66% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:20.399 marked_for_death Fluffy_Pillow 61.0/100: 61% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:20.399 run_through Fluffy_Pillow 61.0/100: 61% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:21.402 saber_slash Fluffy_Pillow 54.4/100: 54% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:22.405 pistol_shot Fluffy_Pillow 20.9/100: 21% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:23.409 saber_slash Fluffy_Pillow 53.3/100: 53% energy | 4.0/6: 67% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:24.414 gouge Fluffy_Pillow 19.8/100: 20% energy | 5.0/6: 83% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:25.419 run_through Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:26.423 Waiting 0.300 sec 29.8/100: 30% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:26.723 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:27.728 pistol_shot Fluffy_Pillow 17.2/100: 17% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
6:28.731 Waiting 0.100 sec 49.6/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
6:28.831 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
6:29.836 Waiting 1.041 sec 17.8/100: 18% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:30.877 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:31.882 Waiting 0.467 sec 17.3/100: 17% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
6:32.349 run_through Fluffy_Pillow 41.0/100: 41% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
6:33.353 adrenaline_rush Fluffy_Pillow 34.5/100: 34% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
6:33.353 Waiting 0.500 sec 34.5/100: 34% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:33.853 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:34.657 ghostly_strike Fluffy_Pillow 43.2/100: 43% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
6:35.461 pistol_shot Fluffy_Pillow 39.6/100: 40% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
6:36.265 sprint Fluffy_Pillow 66.0/100: 66% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:36.265 roll_the_bones Fluffy_Pillow 66.0/100: 66% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones
6:37.069 marked_for_death Fluffy_Pillow 79.4/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:37.069 run_through Fluffy_Pillow 79.4/100: 79% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:37.873 saber_slash Fluffy_Pillow 82.8/100: 83% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:38.679 run_through Fluffy_Pillow 59.2/100: 59% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:39.483 saber_slash Fluffy_Pillow 78.6/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:40.289 pistol_shot Fluffy_Pillow 55.0/100: 55% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:41.095 run_through Fluffy_Pillow 97.5/100: 97% energy | 5.0/6: 83% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:41.898 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:42.702 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=http://us.battle.net/wow/en/tool/talent-calculator#cZ!0002211
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Alacastria

Alacastria : 323472 dps

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
323472.3 323472.3 9879.0 / 3.054% 42699.8 / 13.2% 36372.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.9 8.9 Rage 5.01% 77.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Alacastria 323472
auto_attack_mh 21866 6.8% 122.0 3.31sec 70958 23189 Direct 122.0 56850 115447 71148 24.6%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.00 122.00 0.00 0.00 3.0600 0.0000 8656815.73 12726339.12 31.98 23189.04 23189.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.00 75.41% 56850.08 30934 76483 56759.72 54895 59210 5221620 7676276 31.98
crit 30.00 24.59% 115447.09 61867 152965 114459.43 106275 122796 3435196 5050063 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (2004) 0.0% (0.6%) 2.9 119.55sec 275974 136307

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 8.67 0.00 2.0248 0.5973 0.00 0.00 0.00 136306.52 136306.52
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 2004 0.6% 0.0 0.00sec 0 0 Direct 8.7 88186 150238 94894 9.0%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.67 0.00 0.00 0.0000 0.0000 797256.82 1172043.05 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.89 91.03% 88186.03 63361 145482 86388.56 69697 103155 680202 999961 31.98
crit 0.78 8.97% 150237.96 126722 242471 102974.70 0 242471 117055 172082 21.32
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
Colossus Smash 41448 12.8% 56.6 7.38sec 290325 218147 Direct 56.6 237015 455071 293591 25.3%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.56 56.56 0.00 0.00 1.3309 0.0000 16419474.66 24138183.05 31.98 218146.82 218146.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.22 74.66% 237014.61 129715 347452 233795.03 220758 253505 9901421 14556026 31.98
crit 14.33 25.34% 455070.77 259429 595670 457057.95 412583 512118 6518054 9582157 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 29607 9.1% 0.0 0.00sec 0 0 Periodic 74.1 160434 0 160434 0.0% 37.4%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 74.11 74.11 0.0000 2.0000 11700159.36 11700159.36 0.00 78936.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.1 100.00% 160433.67 15434 369765 158075.81 126178 174561 11700159 11700159 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 41955 13.0% 32.1 2.38sec 518260 377077 Direct 32.1 362609 819246 528757 34.9%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.11 32.11 0.00 0.00 1.3744 0.0000 16641908.21 24465181.43 31.98 377076.82 377076.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.89 65.05% 362609.49 84358 563469 370174.70 318250 411585 7702026 11322708 31.98
crit 11.22 34.95% 819245.83 297317 1213516 794114.19 662744 901025 8939882 13142473 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m3 additional Rage to deal up to ${$sw2*3} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Hamstring 828 0.3% 62.2 6.40sec 5263 0 Direct 62.2 0 5310 5310 100.0%  

Stats details: hamstring

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.22 62.22 0.00 0.00 0.0000 0.0000 327471.35 481413.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 62.22 100.00% 5309.74 2913 7203 5257.44 4806 5656 327471 481414 31.98
 
 

Action details: hamstring

Static Values
  • id:1715
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ptr&buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
Spelldata
  • id:1715
  • name:Hamstring
  • school:physical
  • tooltip:Movement slowed by {$s1=50}%.
  • description:Maims the enemy for $sw3 Physical damage, reducing movement speed by {$s1=50}% for {$d=15 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.05
 
Mortal Strike 108780 33.7% 72.9 5.57sec 591791 448105 Direct 72.9 361565 842106 599537 48.8%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.89 72.89 0.00 0.00 1.3207 0.0000 43135000.99 63412537.32 31.98 448104.64 448104.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.33 51.22% 361564.96 109549 669021 363642.09 332600 397696 13517936 19872646 31.98
crit 35.56 48.78% 842105.53 219099 1338042 832719.33 775762 876402 29617065 43539892 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 24749 7.5% 24.2 18.59sec 395709 0 Direct 24.2 289515 588924 389639 33.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.22 24.22 0.00 0.00 0.0000 0.0000 9584941.89 14090772.49 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.22 66.97% 289514.99 141271 349289 295340.40 285333 308558 4791321 7043696 31.98
crit 8.00 33.03% 588923.78 282542 698579 599786.18 561626 648738 4793621 7047077 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Slam 47342 14.7% 109.6 2.87sec 171237 129338 Direct 109.6 136088 270133 170949 26.4%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.56 109.56 0.00 0.00 1.3240 0.0000 18759923.00 27578863.80 31.98 129337.75 129337.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.67 73.63% 136088.16 75715 187204 136555.70 129147 146229 10972088 16130009 31.98
crit 28.89 26.37% 270133.36 151430 374409 269462.52 237504 294907 7787835 11448855 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 4893 1.5% 6.3 67.97sec 302377 228827 Direct 6.3 239387 492582 303448 24.6%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.33 6.33 0.00 0.00 1.3215 0.0000 1915054.31 1915054.31 0.00 228827.14 228827.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.78 75.44% 239387.02 136265 312876 243111.42 198498 286803 1145192 1145192 0.00
crit 1.56 24.56% 492581.50 272531 673826 468280.89 0 673826 769862 769862 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.8 91.00sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.down&rage.deficit>40
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Avatar 4.8 90.00sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 12.8 32.55sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 4.6 85.15sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
Cleansed Drake's Breath 4.7 111.39sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Focused Rage 124.1 3.24sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Heroic Leap 12.7 32.07sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 6.4 0.9 57.9sec 52.0sec 16.96% 50.37% 0.9(0.9) 6.4

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5114.20

Stack Uptimes

  • acceleration_1:16.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Avatar 4.8 0.0 90.0sec 90.0sec 23.63% 55.81% 0.0(0.0) 4.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:23.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 12.8 0.0 32.7sec 32.7sec 16.04% 49.34% 0.0(0.0) 12.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 2.9 0.0 147.6sec 147.6sec 1.30% 1.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.25% 33.41% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
charge_movement 3.6 0.0 92.5sec 92.5sec 0.53% 13.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • charge_movement_1:0.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Cleansed Ancient's Blessing 2.8 0.0 76.6sec 76.6sec 7.15% 45.80% 0.0(0.0) 2.8

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_ancients_blessing_1:7.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 4.8 0.0 71.4sec 71.4sec 11.48% 46.54% 0.0(0.0) 4.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_sisters_blessing_1:11.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 4.0 0.0 73.2sec 73.2sec 9.75% 45.24% 0.0(0.0) 3.9

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_wisps_blessing_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 12.8 0.0 32.7sec 32.7sec 16.04% 26.33% 0.0(0.0) 12.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 56.6 67.6 7.0sec 3.2sec 53.91% 59.50% 1.2(1.2) 0.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:29.06%
  • focused_rage_2:17.89%
  • focused_rage_3:6.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
heroic_leap_movement 0.4 0.0 0.0sec 0.0sec 0.06% 1.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_heroic_leap_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • heroic_leap_movement_1:0.10%

Trigger Attempt Success

  • trigger_pct:44.44%
Mark of the Heavy Hide 8.9 3.0 40.5sec 30.9sec 26.27% 56.34% 3.0(3.0) 8.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:26.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 334.1sec 0.0sec 12.30% 50.25% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 62.9 0.0 6.3sec 6.4sec 25.88% 43.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.45

Stack Uptimes

  • precise_strikes_1:25.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 4.08% 34.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Shattered Defenses 62.9 0.0 6.3sec 6.4sec 25.88% 44.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:25.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Charge62.02526.629153.094219.351162.682247.647
Battle Cry1.8060.2213.8947.6162.51211.256
Hamstring27.4463.22134.444326.599271.763390.638
Heroic Leap2.6420.01018.63625.82912.33339.860
Focused Rage4.3460.00129.765228.330182.129278.168
Colossus Smash1.3610.0028.77774.52055.71486.698
Warbreaker7.7990.04649.69439.15213.59375.755
Mortal Strike1.6290.00224.469112.93485.915148.154
Bladestorm57.6100.175214.605106.53641.118203.618

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
execute Rage 32.8 651.8 19.9 20.3 25532.5
focused_rage Rage 123.9 853.8 6.9 6.9 0.0
mortal_strike Rage 72.4 576.0 8.0 7.9 74887.2
slam Rage 108.8 1436.3 13.2 13.1 13061.2
Resource Gains Type Count Total Average Overflow
charge Rage 4.62 92.20 (2.59%) 19.98 0.11 0.12%
arcane_torrent Rage 4.85 72.69 (2.04%) 15.00 0.00 0.00%
melee_crit Rage 29.77 1087.09 (30.48%) 36.52 11.14 1.01%
melee_main_hand Rage 92.23 2314.42 (64.90%) 25.09 9.79 0.42%
Resource RPS-Gain RPS-Loss
Rage 8.99 8.87
Combat End Resource Mean Min Max
Rage 83.60 82.20 85.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.3%

Procs

Count Interval
delayed_auto_attack 3.9 87.3sec
tactician 59.9 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Alacastria Damage Per Second
Count 9
Mean 323472.31
Minimum 300443.50
Maximum 351451.33
Spread ( max - min ) 51007.83
Range [ ( max - min ) / 2 * 100% ] 7.88%
Standard Deviation 15121.2309
5th Percentile 300443.50
95th Percentile 343143.33
( 95th Percentile - 5th Percentile ) 42699.83
Mean Distribution
Standard Deviation 5040.4103
95.00% Confidence Intervall ( 313593.29 - 333351.33 )
Normalized 95.00% Confidence Intervall ( 96.95% - 103.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8394
0.1 Scale Factor Error with Delta=300 1951901
0.05 Scale Factor Error with Delta=300 7807607
0.01 Scale Factor Error with Delta=300 195190177
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9
Mean 323472.31
Minimum 300443.50
Maximum 351451.33
Spread ( max - min ) 51007.83
Range [ ( max - min ) / 2 * 100% ] 7.88%
Standard Deviation 15121.2309
5th Percentile 300443.50
95th Percentile 343143.33
( 95th Percentile - 5th Percentile ) 42699.83
Mean Distribution
Standard Deviation 5040.4103
95.00% Confidence Intervall ( 313593.29 - 333351.33 )
Normalized 95.00% Confidence Intervall ( 96.95% - 103.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8394
0.1 Scale Factor Error with Delta=300 1951901
0.05 Scale Factor Error with Delta=300 7807607
0.01 Scale Factor Error with Delta=300 195190177
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9
Mean 323472.31
Minimum 300443.50
Maximum 351451.33
Spread ( max - min ) 51007.83
Range [ ( max - min ) / 2 * 100% ] 7.88%
Damage
Sample Data Alacastria Damage
Count 9
Mean 127938006.32
Minimum 106372234.18
Maximum 149929845.32
Spread ( max - min ) 43557611.14
Range [ ( max - min ) / 2 * 100% ] 17.02%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Alacastria Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Alacastria Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 4.62 charge
6 4.92 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
8 4.85 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
9 12.85 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
A 4.85 avatar,if=(buff.bloodlust.up|time>=1)
B 62.38 hamstring,if=!ptr&buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
C 12.69 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
D 52.77 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike. # In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
E 13.62 colossus_smash,if=debuff.colossus_smash.down
F 1.69 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
G 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
I 0.00 run_action_list,name=execute,if=target.health.pct<=20
J 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
K 3.08 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
L 6.15 execute,if=buff.battle_cry_deadly_calm.up
M 8.00 colossus_smash,if=buff.shattered_defenses.down
N 1.00 warbreaker,if=buff.shattered_defenses.down&rage<=30
O 26.62 execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
P 0.92 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
actions.single
# count action,conditions
Q 3.85 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
R 35.31 colossus_smash,if=buff.shattered_defenses.down
S 3.69 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
T 71.15 focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
U 65.46 mortal_strike
0.00 execute,if=buff.stone_heart.react
V 108.85 slam
0.00 execute,if=equipped.archavons_heavy_hand
0.00 focused_rage,if=equipped.archavons_heavy_hand
W 1.92 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.

Sample Sequence

0124568ETAT9BCUBDRBDUBDRBDVTVUTVTTVSURTTUVVVUVVEUVVVURT9BUDBVDBCRDBUDBVDQRTTVTVUTVT56TUETUTVVVUEURTURTU9BCDRBDUBDBVBDVTVUTETTUVTVSTURVVURVVU8VACVV9BDUBDVBDVBDBEUTVTTVVUVVVUVWVUVVVECU56RT9BDUBDRBDVBDVBDQTVRTTUTRTUTVTVSUTRTUTVVCVUVV9BDVBDEBDBUBDVTVTVUVTVEUTVRTUR8UATVVCVUVEUV9BDVBDVBDBRBQDVTTVVUTVFVU56RTTCUVTRUTVRUV9BDVBDVBDBUBDETUTVTVTVUVVVUVWVECUVVRUV9BDVBDVBDRBBQDTVRTUTVAT8VTSUTVVVUVECURUTVVVU9BDVBDVBDBE56URTTUTVRTURURTUTCVVTVUVVVUEUR9BDUBDVBDBVBDVROMOMOMCOMOMOOOOOEOONA897BDLBDLBDBKBDLMOOOOCOOEPOOOOOE9BDLBDKBDLBBDLMOM

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage potion_of_the_old_war
0:00.000 arcane_torrent Fluffy_Pillow 45.2/130: 35% rage potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 60.2/130: 46% rage potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 48.2/130: 37% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.000 avatar Fluffy_Pillow 48.2/130: 37% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.320 focused_rage Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.323 battle_cry Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.323 hamstring Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.323 heroic_leap Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.323 mortal_strike Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:02.323 hamstring Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
0:02.419 focused_rage Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
0:02.419 colossus_smash Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.323 hamstring Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:03.508 focused_rage Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:03.512 mortal_strike Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:04.323 hamstring Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
0:04.597 focused_rage Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:04.606 colossus_smash Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:05.323 hamstring Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:05.686 focused_rage Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:05.699 slam Fluffy_Pillow 97.7/130: 75% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:06.775 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:06.793 slam Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:07.887 mortal_strike Fluffy_Pillow 102.0/130: 78% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:07.887 focused_rage Fluffy_Pillow 81.2/130: 62% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:08.981 slam Fluffy_Pillow 106.4/130: 82% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:08.981 focused_rage Fluffy_Pillow 78.4/130: 60% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:10.070 focused_rage Fluffy_Pillow 66.4/130: 51% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:10.073 slam Fluffy_Pillow 66.4/130: 51% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:11.167 warbreaker Fluffy_Pillow 50.4/130: 39% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:12.263 mortal_strike Fluffy_Pillow 75.6/130: 58% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:13.357 colossus_smash Fluffy_Pillow 66.8/130: 51% rage bloodlust, avatar, potion_of_the_old_war
0:13.357 focused_rage Fluffy_Pillow 54.8/130: 42% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:14.446 focused_rage Fluffy_Pillow 68.0/130: 52% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:14.450 mortal_strike Fluffy_Pillow 68.0/130: 52% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:15.542 slam Fluffy_Pillow 59.2/130: 46% rage bloodlust, avatar, potion_of_the_old_war
0:16.635 slam Fluffy_Pillow 43.2/130: 33% rage bloodlust, avatar, potion_of_the_old_war
0:17.729 slam Fluffy_Pillow 52.4/130: 40% rage bloodlust, avatar, potion_of_the_old_war
0:18.824 mortal_strike Fluffy_Pillow 36.4/130: 28% rage bloodlust, avatar, potion_of_the_old_war
0:19.919 slam Fluffy_Pillow 45.6/130: 35% rage bloodlust, avatar, potion_of_the_old_war
0:21.012 slam Fluffy_Pillow 29.6/130: 23% rage bloodlust, potion_of_the_old_war
0:22.106 colossus_smash Fluffy_Pillow 38.8/130: 30% rage bloodlust, potion_of_the_old_war
0:23.200 mortal_strike Fluffy_Pillow 38.8/130: 30% rage bloodlust, precise_strikes, shattered_defenses
0:24.292 slam Fluffy_Pillow 30.0/130: 23% rage bloodlust
0:25.386 slam Fluffy_Pillow 39.2/130: 30% rage bloodlust
0:26.340 slam Fluffy_Pillow 23.2/130: 18% rage bloodlust, acceleration
0:27.295 mortal_strike Fluffy_Pillow 44.0/130: 34% rage bloodlust, acceleration
0:28.248 colossus_smash Fluffy_Pillow 28.0/130: 22% rage bloodlust, acceleration
0:29.201 focused_rage Fluffy_Pillow 64.4/130: 50% rage bloodlust, precise_strikes, shattered_defenses, acceleration
0:29.201 battle_cry Fluffy_Pillow 52.4/130: 40% rage bloodlust, focused_rage, precise_strikes, shattered_defenses, acceleration
0:29.201 hamstring Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, acceleration
0:29.201 mortal_strike Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, acceleration
0:30.149 focused_rage Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:30.154 hamstring Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:30.201 slam Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:31.097 focused_rage Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:31.153 hamstring Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:31.201 heroic_leap Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:31.323 colossus_smash Fluffy_Pillow 52.4/130: 40% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:32.045 focused_rage Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
0:32.201 hamstring Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
0:32.276 mortal_strike Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
0:32.993 focused_rage Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:33.201 hamstring Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:33.229 slam Fluffy_Pillow 89.3/130: 69% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:33.941 focused_rage Fluffy_Pillow 126.6/130: 97% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:34.181 mortal_strike Fluffy_Pillow 126.6/130: 97% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:35.132 colossus_smash Fluffy_Pillow 126.6/130: 97% rage bloodlust, acceleration
0:35.132 focused_rage Fluffy_Pillow 114.6/130: 88% rage bloodlust, focused_rage, precise_strikes, shattered_defenses, acceleration
0:36.183 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:36.186 slam Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:37.272 focused_rage Fluffy_Pillow 90.0/130: 69% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:37.281 slam Fluffy_Pillow 90.0/130: 69% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:38.374 mortal_strike Fluffy_Pillow 74.0/130: 57% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:38.374 focused_rage Fluffy_Pillow 53.2/130: 41% rage bloodlust, focused_rage
0:39.467 slam Fluffy_Pillow 78.4/130: 60% rage bloodlust, focused_rage
0:39.467 focused_rage Fluffy_Pillow 50.4/130: 39% rage bloodlust, focused_rage(2)
0:40.560 Waiting 3.100 sec 50.4/130: 39% rage bloodlust, raid_movement, focused_rage(2)
0:43.660 charge Fluffy_Pillow 50.4/130: 39% rage raid_movement, focused_rage(2)
0:43.660 Waiting 0.500 sec 70.4/130: 54% rage raid_movement, charge_movement, focused_rage(2)
0:44.160 auto_attack Fluffy_Pillow 70.4/130: 54% rage raid_movement, charge_movement, focused_rage(2)
0:44.160 focused_rage Fluffy_Pillow 95.6/130: 74% rage raid_movement, charge_movement, focused_rage(2)
0:44.160 mortal_strike Fluffy_Pillow 83.6/130: 64% rage raid_movement, charge_movement, focused_rage(3)
0:45.582 colossus_smash Fluffy_Pillow 67.6/130: 52% rage
0:45.582 focused_rage Fluffy_Pillow 55.6/130: 43% rage focused_rage, precise_strikes, shattered_defenses
0:47.003 mortal_strike Fluffy_Pillow 55.6/130: 43% rage focused_rage, precise_strikes, shattered_defenses
0:47.603 focused_rage Fluffy_Pillow 60.0/130: 46% rage focused_rage, cleansed_sisters_blessing
0:48.326 slam Fluffy_Pillow 60.0/130: 46% rage focused_rage, cleansed_sisters_blessing
0:49.649 slam Fluffy_Pillow 44.0/130: 34% rage focused_rage, cleansed_sisters_blessing
0:50.973 slam Fluffy_Pillow 53.2/130: 41% rage focused_rage, cleansed_sisters_blessing
0:52.296 mortal_strike Fluffy_Pillow 37.2/130: 29% rage focused_rage, cleansed_sisters_blessing
0:53.620 colossus_smash Fluffy_Pillow 21.2/130: 16% rage cleansed_sisters_blessing
0:54.942 mortal_strike Fluffy_Pillow 46.4/130: 36% rage precise_strikes, shattered_defenses, cleansed_sisters_blessing, cleansed_wisps_blessing
0:56.263 colossus_smash Fluffy_Pillow 37.6/130: 29% rage cleansed_sisters_blessing, cleansed_wisps_blessing
0:57.063 focused_rage Fluffy_Pillow 50.8/130: 39% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
0:57.625 mortal_strike Fluffy_Pillow 50.8/130: 39% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
0:59.043 colossus_smash Fluffy_Pillow 42.0/130: 32% rage cleansed_wisps_blessing
1:00.443 focused_rage Fluffy_Pillow 55.2/130: 42% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
1:00.464 mortal_strike Fluffy_Pillow 55.2/130: 42% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
1:01.886 battle_cry Fluffy_Pillow 46.4/130: 36% rage cleansed_wisps_blessing
1:01.886 hamstring Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, battle_cry, cleansed_wisps_blessing
1:01.886 heroic_leap Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, battle_cry, cleansed_wisps_blessing
1:01.886 focused_rage Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, battle_cry, cleansed_wisps_blessing
1:01.886 colossus_smash Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_wisps_blessing
1:02.886 hamstring Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
1:03.302 focused_rage Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
1:03.306 mortal_strike Fluffy_Pillow 46.4/130: 36% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
1:03.886 hamstring Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, battle_cry
1:04.718 focused_rage Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:04.729 hamstring Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:04.886 slam Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:05.886 hamstring Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:06.134 focused_rage Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:06.306 slam Fluffy_Pillow 82.7/130: 64% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:07.550 focused_rage Fluffy_Pillow 107.1/130: 82% rage focused_rage(3)
1:07.727 slam Fluffy_Pillow 107.1/130: 82% rage focused_rage(3)
1:09.146 mortal_strike Fluffy_Pillow 91.1/130: 70% rage focused_rage(3)
1:09.146 focused_rage Fluffy_Pillow 63.1/130: 49% rage focused_rage
1:10.566 colossus_smash Fluffy_Pillow 63.1/130: 49% rage focused_rage
1:10.566 focused_rage Fluffy_Pillow 51.1/130: 39% rage focused_rage(2), precise_strikes, shattered_defenses
1:11.982 focused_rage Fluffy_Pillow 64.3/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses
1:11.987 mortal_strike Fluffy_Pillow 64.3/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses
1:13.409 slam Fluffy_Pillow 55.5/130: 43% rage
1:14.009 focused_rage Fluffy_Pillow 52.7/130: 41% rage focused_rage
1:14.831 slam Fluffy_Pillow 52.7/130: 41% rage focused_rage
1:16.253 warbreaker Fluffy_Pillow 36.7/130: 28% rage focused_rage
1:17.453 focused_rage Fluffy_Pillow 49.9/130: 38% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:17.673 mortal_strike Fluffy_Pillow 49.9/130: 38% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:19.095 colossus_smash Fluffy_Pillow 41.1/130: 32% rage mark_of_the_heavy_hide
1:20.515 slam Fluffy_Pillow 41.1/130: 32% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:21.936 slam Fluffy_Pillow 50.3/130: 39% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:23.355 mortal_strike Fluffy_Pillow 34.3/130: 26% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:24.777 colossus_smash Fluffy_Pillow 50.7/130: 39% rage cleansed_wisps_blessing, mark_of_the_heavy_hide
1:26.198 slam Fluffy_Pillow 50.7/130: 39% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:27.617 slam Fluffy_Pillow 59.9/130: 46% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:29.039 mortal_strike Fluffy_Pillow 43.9/130: 34% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:30.460 arcane_torrent Fluffy_Pillow 35.1/130: 27% rage cleansed_wisps_blessing, mark_of_the_heavy_hide
1:30.460 slam Fluffy_Pillow 50.1/130: 39% rage cleansed_wisps_blessing, mark_of_the_heavy_hide
1:31.000 avatar Fluffy_Pillow 59.3/130: 46% rage avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:31.881 heroic_leap Fluffy_Pillow 59.3/130: 46% rage avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:31.886 slam Fluffy_Pillow 59.3/130: 46% rage avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:33.307 slam Fluffy_Pillow 43.3/130: 33% rage avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:34.629 battle_cry Fluffy_Pillow 52.5/130: 40% rage avatar, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:34.629 hamstring Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:34.629 focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:34.629 mortal_strike Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:35.629 hamstring Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:35.947 focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:35.952 slam Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:36.629 hamstring Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:37.265 focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:37.274 slam Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
1:37.629 hamstring Fluffy_Pillow 88.6/130: 68% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing
1:38.583 focused_rage Fluffy_Pillow 88.6/130: 68% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing
1:38.596 hamstring Fluffy_Pillow 88.6/130: 68% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing
1:38.629 colossus_smash Fluffy_Pillow 88.6/130: 68% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing
1:39.951 mortal_strike Fluffy_Pillow 88.6/130: 68% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing
1:39.951 focused_rage Fluffy_Pillow 67.8/130: 52% rage avatar, focused_rage, cleansed_sisters_blessing
1:41.275 slam Fluffy_Pillow 93.0/130: 72% rage avatar, focused_rage, cleansed_sisters_blessing
1:41.275 focused_rage Fluffy_Pillow 65.0/130: 50% rage avatar, focused_rage(2), cleansed_sisters_blessing
1:42.593 focused_rage Fluffy_Pillow 53.0/130: 41% rage avatar, focused_rage(3), cleansed_sisters_blessing
1:42.598 slam Fluffy_Pillow 53.0/130: 41% rage avatar, focused_rage(3), cleansed_sisters_blessing
1:43.963 slam Fluffy_Pillow 62.2/130: 48% rage avatar, focused_rage(3)
1:45.385 mortal_strike Fluffy_Pillow 46.2/130: 36% rage avatar, focused_rage(3)
1:46.804 slam Fluffy_Pillow 30.2/130: 23% rage avatar
1:48.224 slam Fluffy_Pillow 51.6/130: 40% rage avatar
1:49.645 slam Fluffy_Pillow 35.6/130: 27% rage avatar
1:51.065 mortal_strike Fluffy_Pillow 44.8/130: 34% rage
1:52.486 slam Fluffy_Pillow 28.8/130: 22% rage
1:53.907 bladestorm Fluffy_Pillow 12.8/130: 10% rage
1:55.988 slam Fluffy_Pillow 38.0/130: 29% rage
1:57.407 mortal_strike Fluffy_Pillow 22.0/130: 17% rage
1:58.645 slam Fluffy_Pillow 31.2/130: 24% rage acceleration
1:59.883 Waiting 0.600 sec 15.2/130: 12% rage acceleration
2:00.483 slam Fluffy_Pillow 40.4/130: 31% rage acceleration
2:01.721 slam Fluffy_Pillow 24.4/130: 19% rage acceleration
2:02.958 colossus_smash Fluffy_Pillow 8.4/130: 6% rage acceleration
2:04.197 heroic_leap Fluffy_Pillow 33.6/130: 26% rage precise_strikes, shattered_defenses, acceleration
2:04.197 mortal_strike Fluffy_Pillow 33.6/130: 26% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:05.435 Waiting 3.200 sec 24.8/130: 19% rage raid_movement, mark_of_the_heavy_hide, acceleration
2:08.635 charge Fluffy_Pillow 24.8/130: 19% rage raid_movement, mark_of_the_heavy_hide, acceleration
2:08.635 Waiting 0.600 sec 44.8/130: 34% rage raid_movement, charge_movement, mark_of_the_heavy_hide, acceleration
2:09.235 auto_attack Fluffy_Pillow 44.8/130: 34% rage mark_of_the_heavy_hide, acceleration
2:09.235 colossus_smash Fluffy_Pillow 70.0/130: 54% rage mark_of_the_heavy_hide, acceleration
2:09.235 focused_rage Fluffy_Pillow 58.0/130: 45% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:10.473 battle_cry Fluffy_Pillow 58.0/130: 45% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:10.473 hamstring Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:10.473 focused_rage Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:10.473 mortal_strike Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:11.473 hamstring Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, battle_cry, mark_of_the_heavy_hide, acceleration
2:11.706 focused_rage Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
2:11.711 colossus_smash Fluffy_Pillow 58.0/130: 45% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
2:12.473 hamstring Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:12.939 focused_rage Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:12.947 slam Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:13.473 hamstring Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:14.172 focused_rage Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:14.184 slam Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
2:14.473 hamstring Fluffy_Pillow 95.0/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
2:15.405 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
2:15.421 mortal_strike Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, acceleration
2:16.638 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage, acceleration
2:16.657 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage, acceleration
2:17.893 colossus_smash Fluffy_Pillow 102.0/130: 78% rage focused_rage, acceleration
2:17.893 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(2), precise_strikes, shattered_defenses, acceleration
2:19.198 focused_rage Fluffy_Pillow 103.2/130: 79% rage focused_rage(3), precise_strikes, shattered_defenses
2:19.203 mortal_strike Fluffy_Pillow 103.2/130: 79% rage focused_rage(3), precise_strikes, shattered_defenses
2:20.614 focused_rage Fluffy_Pillow 82.4/130: 63% rage focused_rage
2:20.624 colossus_smash Fluffy_Pillow 82.4/130: 63% rage focused_rage
2:22.030 focused_rage Fluffy_Pillow 95.6/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
2:22.045 mortal_strike Fluffy_Pillow 95.6/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
2:23.446 focused_rage Fluffy_Pillow 74.8/130: 58% rage focused_rage
2:23.463 slam Fluffy_Pillow 74.8/130: 58% rage focused_rage
2:24.863 focused_rage Fluffy_Pillow 72.0/130: 55% rage focused_rage(2), mark_of_the_heavy_hide
2:24.884 slam Fluffy_Pillow 72.0/130: 55% rage focused_rage(2), mark_of_the_heavy_hide
2:26.303 warbreaker Fluffy_Pillow 56.0/130: 43% rage focused_rage(2), mark_of_the_heavy_hide
2:27.722 mortal_strike Fluffy_Pillow 56.0/130: 43% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:28.322 focused_rage Fluffy_Pillow 60.4/130: 46% rage focused_rage, mark_of_the_heavy_hide
2:29.143 colossus_smash Fluffy_Pillow 60.4/130: 46% rage focused_rage, mark_of_the_heavy_hide
2:29.738 focused_rage Fluffy_Pillow 48.4/130: 37% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:30.564 mortal_strike Fluffy_Pillow 48.4/130: 37% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:31.664 focused_rage Fluffy_Pillow 52.8/130: 41% rage focused_rage, mark_of_the_heavy_hide
2:31.986 slam Fluffy_Pillow 52.8/130: 41% rage focused_rage, mark_of_the_heavy_hide
2:33.406 slam Fluffy_Pillow 36.8/130: 28% rage focused_rage, mark_of_the_heavy_hide
2:34.826 heroic_leap Fluffy_Pillow 20.8/130: 16% rage focused_rage, mark_of_the_heavy_hide
2:34.826 slam Fluffy_Pillow 20.8/130: 16% rage focused_rage, mark_of_the_heavy_hide
2:36.247 mortal_strike Fluffy_Pillow 41.4/130: 32% rage focused_rage
2:37.666 slam Fluffy_Pillow 25.4/130: 20% rage
2:39.088 slam Fluffy_Pillow 34.6/130: 27% rage
2:40.508 battle_cry Fluffy_Pillow 18.6/130: 14% rage
2:40.553 hamstring Fluffy_Pillow 18.6/130: 14% rage corrupted_blood_of_zakajz, battle_cry
2:40.553 focused_rage Fluffy_Pillow 18.6/130: 14% rage corrupted_blood_of_zakajz, battle_cry
2:40.553 slam Fluffy_Pillow 18.6/130: 14% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:41.553 hamstring Fluffy_Pillow 18.6/130: 14% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:41.969 focused_rage Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:41.975 colossus_smash Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:42.553 hamstring Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:43.385 focused_rage Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:43.396 hamstring Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:43.553 mortal_strike Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:44.553 hamstring Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, battle_cry
2:44.801 focused_rage Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:44.972 slam Fluffy_Pillow 55.7/130: 43% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:46.217 focused_rage Fluffy_Pillow 80.5/130: 62% rage focused_rage(2)
2:46.392 slam Fluffy_Pillow 80.5/130: 62% rage focused_rage(2)
2:47.633 focused_rage Fluffy_Pillow 52.5/130: 40% rage focused_rage(3), acceleration
2:47.788 slam Fluffy_Pillow 52.5/130: 40% rage focused_rage(3), acceleration
2:49.024 mortal_strike Fluffy_Pillow 73.0/130: 56% rage focused_rage(3), acceleration
2:50.261 slam Fluffy_Pillow 57.0/130: 44% rage acceleration
2:51.461 focused_rage Fluffy_Pillow 54.2/130: 42% rage focused_rage, acceleration
2:51.500 slam Fluffy_Pillow 54.2/130: 42% rage focused_rage, acceleration
2:52.738 colossus_smash Fluffy_Pillow 38.2/130: 29% rage focused_rage, acceleration
2:53.976 mortal_strike Fluffy_Pillow 38.2/130: 29% rage focused_rage, precise_strikes, shattered_defenses, acceleration
2:54.476 focused_rage Fluffy_Pillow 54.6/130: 42% rage focused_rage, acceleration
2:55.212 slam Fluffy_Pillow 54.6/130: 42% rage focused_rage, acceleration
2:56.450 colossus_smash Fluffy_Pillow 38.6/130: 30% rage focused_rage, acceleration
2:57.450 focused_rage Fluffy_Pillow 51.8/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses, acceleration
2:57.695 mortal_strike Fluffy_Pillow 51.8/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
2:59.115 colossus_smash Fluffy_Pillow 43.0/130: 33% rage
3:00.537 arcane_torrent Fluffy_Pillow 43.0/130: 33% rage precise_strikes, shattered_defenses
3:00.537 mortal_strike Fluffy_Pillow 58.0/130: 45% rage precise_strikes, shattered_defenses
3:01.000 avatar Fluffy_Pillow 74.4/130: 57% rage avatar
3:01.100 focused_rage Fluffy_Pillow 62.4/130: 48% rage avatar, focused_rage
3:01.959 slam Fluffy_Pillow 62.4/130: 48% rage avatar, focused_rage
3:03.382 slam Fluffy_Pillow 46.4/130: 36% rage avatar, focused_rage
3:04.801 heroic_leap Fluffy_Pillow 55.6/130: 43% rage avatar, focused_rage
3:04.826 slam Fluffy_Pillow 55.6/130: 43% rage avatar, focused_rage
3:06.245 mortal_strike Fluffy_Pillow 39.6/130: 30% rage avatar, focused_rage
3:07.664 slam Fluffy_Pillow 48.8/130: 38% rage avatar
3:09.084 colossus_smash Fluffy_Pillow 32.8/130: 25% rage avatar
3:10.504 mortal_strike Fluffy_Pillow 32.8/130: 25% rage avatar, precise_strikes, shattered_defenses
3:11.924 slam Fluffy_Pillow 49.2/130: 38% rage avatar, mark_of_the_heavy_hide
3:13.344 battle_cry Fluffy_Pillow 33.2/130: 26% rage avatar, mark_of_the_heavy_hide
3:13.344 hamstring Fluffy_Pillow 33.2/130: 26% rage avatar, corrupted_blood_of_zakajz, battle_cry, mark_of_the_heavy_hide
3:13.344 focused_rage Fluffy_Pillow 33.2/130: 26% rage avatar, corrupted_blood_of_zakajz, battle_cry, mark_of_the_heavy_hide
3:13.344 slam Fluffy_Pillow 33.2/130: 26% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
3:14.344 hamstring Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
3:14.760 focused_rage Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
3:14.763 slam Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
3:15.344 hamstring Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
3:16.176 focused_rage Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide
3:16.183 hamstring Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide
3:16.344 colossus_smash Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide
3:17.344 hamstring Fluffy_Pillow 69.8/130: 54% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
3:17.764 mortal_strike Fluffy_Pillow 106.7/130: 82% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
3:17.764 focused_rage Fluffy_Pillow 106.7/130: 82% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
3:19.184 slam Fluffy_Pillow 106.7/130: 82% rage avatar, focused_rage, mark_of_the_heavy_hide
3:19.184 focused_rage Fluffy_Pillow 78.7/130: 61% rage avatar, focused_rage(2), mark_of_the_heavy_hide
3:20.600 focused_rage Fluffy_Pillow 66.7/130: 51% rage avatar, focused_rage(3)
3:20.603 slam Fluffy_Pillow 66.7/130: 51% rage avatar, focused_rage(3)
3:22.024 slam Fluffy_Pillow 75.9/130: 58% rage focused_rage(3)
3:23.445 mortal_strike Fluffy_Pillow 59.9/130: 46% rage focused_rage(3)
3:24.545 focused_rage Fluffy_Pillow 57.1/130: 44% rage focused_rage
3:24.864 slam Fluffy_Pillow 57.1/130: 44% rage focused_rage
3:26.285 warbreaker Fluffy_Pillow 41.1/130: 32% rage focused_rage
3:27.725 slam Fluffy_Pillow 41.1/130: 32% rage focused_rage, precise_strikes, shattered_defenses
3:29.145 mortal_strike Fluffy_Pillow 50.3/130: 39% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
3:30.564 Waiting 3.100 sec 41.5/130: 32% rage raid_movement, cleansed_wisps_blessing
3:33.664 charge Fluffy_Pillow 41.5/130: 32% rage raid_movement, cleansed_wisps_blessing
3:33.664 Waiting 0.500 sec 61.5/130: 47% rage raid_movement, charge_movement, cleansed_wisps_blessing
3:34.164 auto_attack Fluffy_Pillow 61.5/130: 47% rage raid_movement, charge_movement, cleansed_wisps_blessing
3:34.164 colossus_smash Fluffy_Pillow 86.7/130: 67% rage raid_movement, charge_movement, cleansed_wisps_blessing
3:34.164 focused_rage Fluffy_Pillow 74.7/130: 57% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing
3:35.580 focused_rage Fluffy_Pillow 62.7/130: 48% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
3:35.584 heroic_leap Fluffy_Pillow 62.7/130: 48% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
3:35.584 mortal_strike Fluffy_Pillow 62.7/130: 48% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
3:37.003 slam Fluffy_Pillow 53.9/130: 41% rage cleansed_wisps_blessing
3:37.603 focused_rage Fluffy_Pillow 51.1/130: 39% rage focused_rage, cleansed_wisps_blessing
3:38.424 colossus_smash Fluffy_Pillow 51.1/130: 39% rage focused_rage
3:39.845 mortal_strike Fluffy_Pillow 51.1/130: 39% rage focused_rage, precise_strikes, shattered_defenses
3:41.045 focused_rage Fluffy_Pillow 55.5/130: 43% rage focused_rage
3:41.267 slam Fluffy_Pillow 55.5/130: 43% rage focused_rage
3:42.687 colossus_smash Fluffy_Pillow 39.5/130: 30% rage focused_rage
3:44.110 mortal_strike Fluffy_Pillow 39.5/130: 30% rage focused_rage, precise_strikes, shattered_defenses
3:45.531 slam Fluffy_Pillow 55.9/130: 43% rage
3:46.952 battle_cry Fluffy_Pillow 39.9/130: 31% rage
3:47.024 hamstring Fluffy_Pillow 39.9/130: 31% rage corrupted_blood_of_zakajz, battle_cry
3:47.024 focused_rage Fluffy_Pillow 39.9/130: 31% rage corrupted_blood_of_zakajz, battle_cry
3:47.024 slam Fluffy_Pillow 39.9/130: 31% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:48.024 hamstring Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:48.440 focused_rage Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:48.444 slam Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:49.024 hamstring Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:49.856 focused_rage Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:49.864 hamstring Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:50.024 mortal_strike Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:51.024 hamstring Fluffy_Pillow 76.5/130: 59% rage corrupted_blood_of_zakajz, battle_cry
3:51.272 focused_rage Fluffy_Pillow 112.6/130: 87% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:51.444 colossus_smash Fluffy_Pillow 112.6/130: 87% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:52.688 focused_rage Fluffy_Pillow 100.6/130: 77% rage focused_rage(2), precise_strikes, shattered_defenses
3:52.865 mortal_strike Fluffy_Pillow 100.6/130: 77% rage focused_rage(2), precise_strikes, shattered_defenses
3:54.104 focused_rage Fluffy_Pillow 79.8/130: 61% rage focused_rage
3:54.284 slam Fluffy_Pillow 79.8/130: 61% rage focused_rage
3:55.520 focused_rage Fluffy_Pillow 77.0/130: 59% rage focused_rage(2), cleansed_wisps_blessing
3:55.705 slam Fluffy_Pillow 77.0/130: 59% rage focused_rage(2), cleansed_wisps_blessing
3:56.936 focused_rage Fluffy_Pillow 49.0/130: 38% rage focused_rage(3), cleansed_wisps_blessing
3:57.125 slam Fluffy_Pillow 49.0/130: 38% rage focused_rage(3), cleansed_wisps_blessing
3:58.546 mortal_strike Fluffy_Pillow 58.2/130: 45% rage focused_rage(3), cleansed_wisps_blessing
3:59.966 slam Fluffy_Pillow 42.2/130: 32% rage cleansed_wisps_blessing
4:01.384 slam Fluffy_Pillow 51.4/130: 40% rage cleansed_wisps_blessing
4:02.804 slam Fluffy_Pillow 35.4/130: 27% rage cleansed_wisps_blessing
4:04.226 mortal_strike Fluffy_Pillow 19.4/130: 15% rage cleansed_wisps_blessing
4:05.647 slam Fluffy_Pillow 28.6/130: 22% rage
4:07.069 bladestorm Fluffy_Pillow 12.6/130: 10% rage
4:09.281 slam Fluffy_Pillow 37.8/130: 29% rage
4:10.702 colossus_smash Fluffy_Pillow 21.8/130: 17% rage
4:12.124 heroic_leap Fluffy_Pillow 47.0/130: 36% rage precise_strikes, shattered_defenses
4:12.124 mortal_strike Fluffy_Pillow 47.0/130: 36% rage precise_strikes, shattered_defenses
4:13.545 slam Fluffy_Pillow 38.2/130: 29% rage
4:14.965 slam Fluffy_Pillow 47.4/130: 36% rage
4:16.385 colossus_smash Fluffy_Pillow 31.4/130: 24% rage
4:17.806 mortal_strike Fluffy_Pillow 31.4/130: 24% rage precise_strikes, shattered_defenses
4:19.228 slam Fluffy_Pillow 47.8/130: 37% rage
4:20.551 battle_cry Fluffy_Pillow 31.8/130: 24% rage cleansed_sisters_blessing
4:20.551 hamstring Fluffy_Pillow 31.8/130: 24% rage corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing
4:20.551 focused_rage Fluffy_Pillow 31.8/130: 24% rage corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing
4:20.551 slam Fluffy_Pillow 31.8/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing
4:21.551 hamstring Fluffy_Pillow 31.8/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing
4:21.869 focused_rage Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing
4:21.874 slam Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing
4:22.551 hamstring Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing
4:23.187 focused_rage Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing
4:23.196 colossus_smash Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing
4:23.551 hamstring Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing
4:24.519 hamstring Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing
4:24.551 mortal_strike Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing
4:24.551 focused_rage Fluffy_Pillow 68.9/130: 53% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing
4:25.869 focused_rage Fluffy_Pillow 94.2/130: 72% rage focused_rage(2), cleansed_sisters_blessing
4:25.874 slam Fluffy_Pillow 94.2/130: 72% rage focused_rage(2), cleansed_sisters_blessing
4:27.196 colossus_smash Fluffy_Pillow 78.2/130: 60% rage focused_rage(2), cleansed_sisters_blessing
4:27.196 focused_rage Fluffy_Pillow 66.2/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:28.519 mortal_strike Fluffy_Pillow 91.4/130: 70% rage focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:28.519 focused_rage Fluffy_Pillow 70.6/130: 54% rage focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:29.885 slam Fluffy_Pillow 70.6/130: 54% rage focused_rage, mark_of_the_heavy_hide
4:31.000 avatar Fluffy_Pillow 54.6/130: 42% rage avatar, focused_rage, mark_of_the_heavy_hide
4:31.200 focused_rage Fluffy_Pillow 67.8/130: 52% rage avatar, focused_rage(2), mark_of_the_heavy_hide
4:31.305 arcane_torrent Fluffy_Pillow 67.8/130: 52% rage avatar, focused_rage(2), mark_of_the_heavy_hide
4:31.305 slam Fluffy_Pillow 82.8/130: 64% rage avatar, focused_rage(2), mark_of_the_heavy_hide
4:32.616 focused_rage Fluffy_Pillow 54.8/130: 42% rage avatar, focused_rage(3), mark_of_the_heavy_hide, acceleration
4:32.712 warbreaker Fluffy_Pillow 54.8/130: 42% rage avatar, focused_rage(3), mark_of_the_heavy_hide, acceleration
4:33.948 mortal_strike Fluffy_Pillow 54.8/130: 42% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:34.348 focused_rage Fluffy_Pillow 59.2/130: 46% rage avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, acceleration
4:35.185 slam Fluffy_Pillow 59.2/130: 46% rage avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, acceleration
4:36.423 slam Fluffy_Pillow 43.2/130: 33% rage avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, acceleration
4:37.587 slam Fluffy_Pillow 52.4/130: 40% rage avatar, focused_rage, cleansed_sisters_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide, acceleration
4:38.750 mortal_strike Fluffy_Pillow 36.4/130: 28% rage avatar, focused_rage, cleansed_sisters_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide, acceleration
4:39.912 slam Fluffy_Pillow 20.4/130: 16% rage avatar, cleansed_sisters_blessing, cleansed_wisps_blessing, acceleration
4:41.073 colossus_smash Fluffy_Pillow 29.6/130: 23% rage avatar, cleansed_sisters_blessing, cleansed_wisps_blessing, acceleration
4:42.237 heroic_leap Fluffy_Pillow 29.6/130: 23% rage avatar, precise_strikes, shattered_defenses, cleansed_sisters_blessing, cleansed_wisps_blessing, acceleration
4:42.237 mortal_strike Fluffy_Pillow 29.6/130: 23% rage avatar, precise_strikes, shattered_defenses, cleansed_sisters_blessing, cleansed_wisps_blessing, acceleration
4:43.504 colossus_smash Fluffy_Pillow 46.0/130: 35% rage avatar, cleansed_sisters_blessing, cleansed_wisps_blessing
4:44.826 mortal_strike Fluffy_Pillow 46.0/130: 35% rage avatar, precise_strikes, shattered_defenses, cleansed_sisters_blessing
4:46.026 focused_rage Fluffy_Pillow 50.4/130: 39% rage avatar, focused_rage, cleansed_sisters_blessing
4:46.148 slam Fluffy_Pillow 50.4/130: 39% rage avatar, focused_rage, cleansed_sisters_blessing
4:47.545 slam Fluffy_Pillow 34.4/130: 26% rage avatar, focused_rage
4:48.966 slam Fluffy_Pillow 18.4/130: 14% rage avatar, focused_rage
4:50.386 mortal_strike Fluffy_Pillow 27.6/130: 21% rage avatar, focused_rage
4:51.806 battle_cry Fluffy_Pillow 11.6/130: 9% rage
4:51.806 hamstring Fluffy_Pillow 11.6/130: 9% rage corrupted_blood_of_zakajz, battle_cry
4:51.806 focused_rage Fluffy_Pillow 11.6/130: 9% rage corrupted_blood_of_zakajz, battle_cry, mark_of_the_heavy_hide
4:51.806 slam Fluffy_Pillow 11.6/130: 9% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
4:52.806 hamstring Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
4:53.222 focused_rage Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
4:53.228 slam Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
4:53.806 hamstring Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
4:54.638 focused_rage Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:54.648 hamstring Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:54.806 colossus_smash Fluffy_Pillow 49.1/130: 38% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:56.228 Waiting 2.500 sec 49.1/130: 38% rage raid_movement, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:58.728 charge Fluffy_Pillow 49.1/130: 38% rage raid_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:58.728 Waiting 0.500 sec 69.1/130: 53% rage raid_movement, charge_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:59.228 auto_attack Fluffy_Pillow 69.1/130: 53% rage raid_movement, charge_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
4:59.228 mortal_strike Fluffy_Pillow 94.3/130: 73% rage raid_movement, charge_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:00.649 colossus_smash Fluffy_Pillow 85.5/130: 66% rage cleansed_wisps_blessing, mark_of_the_heavy_hide
5:00.649 focused_rage Fluffy_Pillow 73.5/130: 57% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:02.065 focused_rage Fluffy_Pillow 61.5/130: 47% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:02.069 mortal_strike Fluffy_Pillow 61.5/130: 47% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:03.481 focused_rage Fluffy_Pillow 65.9/130: 51% rage focused_rage, cleansed_wisps_blessing
5:03.491 slam Fluffy_Pillow 65.9/130: 51% rage focused_rage, cleansed_wisps_blessing
5:04.912 colossus_smash Fluffy_Pillow 49.9/130: 38% rage focused_rage
5:06.112 focused_rage Fluffy_Pillow 63.1/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses
5:06.333 mortal_strike Fluffy_Pillow 63.1/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses
5:07.753 colossus_smash Fluffy_Pillow 54.3/130: 42% rage
5:09.172 mortal_strike Fluffy_Pillow 54.3/130: 42% rage precise_strikes, shattered_defenses
5:10.408 colossus_smash Fluffy_Pillow 70.7/130: 54% rage acceleration
5:10.408 focused_rage Fluffy_Pillow 58.7/130: 45% rage focused_rage, precise_strikes, shattered_defenses, acceleration
5:11.646 mortal_strike Fluffy_Pillow 58.7/130: 45% rage focused_rage, precise_strikes, shattered_defenses, acceleration
5:12.446 focused_rage Fluffy_Pillow 63.1/130: 49% rage focused_rage, cleansed_wisps_blessing, acceleration
5:12.884 heroic_leap Fluffy_Pillow 63.1/130: 49% rage focused_rage, cleansed_wisps_blessing, acceleration
5:12.884 slam Fluffy_Pillow 63.1/130: 49% rage focused_rage, cleansed_wisps_blessing, acceleration
5:14.122 slam Fluffy_Pillow 47.1/130: 36% rage focused_rage, cleansed_wisps_blessing, acceleration
5:15.322 focused_rage Fluffy_Pillow 55.6/130: 43% rage focused_rage(2), cleansed_wisps_blessing, acceleration
5:15.359 slam Fluffy_Pillow 55.6/130: 43% rage focused_rage(2), cleansed_wisps_blessing, acceleration
5:16.597 mortal_strike Fluffy_Pillow 39.6/130: 30% rage focused_rage(2), cleansed_wisps_blessing, acceleration
5:17.834 slam Fluffy_Pillow 23.6/130: 18% rage cleansed_wisps_blessing, acceleration
5:19.072 slam Fluffy_Pillow 32.8/130: 25% rage cleansed_wisps_blessing, acceleration
5:20.310 slam Fluffy_Pillow 16.8/130: 13% rage cleansed_wisps_blessing, acceleration
5:21.548 mortal_strike Fluffy_Pillow 38.3/130: 29% rage cleansed_wisps_blessing, acceleration
5:22.787 colossus_smash Fluffy_Pillow 22.3/130: 17% rage acceleration
5:24.027 mortal_strike Fluffy_Pillow 22.3/130: 17% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing, acceleration
5:25.434 colossus_smash Fluffy_Pillow 38.7/130: 30% rage cleansed_wisps_blessing
5:26.856 battle_cry Fluffy_Pillow 38.7/130: 30% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:26.856 hamstring Fluffy_Pillow 38.7/130: 30% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
5:26.856 focused_rage Fluffy_Pillow 38.7/130: 30% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
5:26.856 mortal_strike Fluffy_Pillow 38.7/130: 30% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing
5:27.856 hamstring Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, battle_cry, cleansed_wisps_blessing
5:28.272 focused_rage Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_wisps_blessing
5:28.278 slam Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_wisps_blessing
5:28.856 hamstring Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_wisps_blessing
5:29.688 focused_rage Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:29.698 hamstring Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:29.856 slam Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:30.856 hamstring Fluffy_Pillow 75.8/130: 58% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:31.104 focused_rage Fluffy_Pillow 112.6/130: 87% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:31.275 slam Fluffy_Pillow 112.6/130: 87% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_ancients_blessing, cleansed_wisps_blessing
5:32.695 colossus_smash Fluffy_Pillow 112.6/130: 87% rage focused_rage(3), cleansed_ancients_blessing, cleansed_wisps_blessing
5:34.116 execute Fluffy_Pillow 112.6/130: 87% rage focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing
5:35.536 colossus_smash Fluffy_Pillow 120.2/130: 92% rage focused_rage(3), cleansed_ancients_blessing
5:36.960 execute Fluffy_Pillow 120.2/130: 92% rage focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing
5:38.380 colossus_smash Fluffy_Pillow 127.8/130: 98% rage focused_rage(3), cleansed_ancients_blessing
5:39.802 execute Fluffy_Pillow 127.8/130: 98% rage focused_rage(3), precise_strikes, shattered_defenses
5:41.222 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage(3)
5:42.643 heroic_leap Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
5:42.884 execute Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
5:44.305 colossus_smash Fluffy_Pillow 112.4/130: 86% rage focused_rage(3)
5:45.726 execute Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
5:47.145 colossus_smash Fluffy_Pillow 112.4/130: 86% rage focused_rage(3)
5:48.566 execute Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
5:49.986 execute Fluffy_Pillow 112.4/130: 86% rage focused_rage(3)
5:51.406 execute Fluffy_Pillow 105.6/130: 81% rage focused_rage(3)
5:52.826 execute Fluffy_Pillow 73.6/130: 57% rage focused_rage(3)
5:54.246 execute Fluffy_Pillow 41.6/130: 32% rage focused_rage(3)
5:55.668 colossus_smash Fluffy_Pillow 34.8/130: 27% rage focused_rage(3)
5:57.088 execute Fluffy_Pillow 34.8/130: 27% rage focused_rage(3), precise_strikes, shattered_defenses
5:58.508 execute Fluffy_Pillow 42.4/130: 33% rage focused_rage(3)
5:59.930 warbreaker Fluffy_Pillow 10.4/130: 8% rage focused_rage(3)
6:01.000 avatar Fluffy_Pillow 10.4/130: 8% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
6:01.351 arcane_torrent Fluffy_Pillow 10.4/130: 8% rage avatar, precise_strikes, shattered_defenses
6:01.351 battle_cry Fluffy_Pillow 25.4/130: 20% rage avatar, precise_strikes, shattered_defenses
6:01.351 potion Fluffy_Pillow 25.4/130: 20% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
6:01.351 hamstring Fluffy_Pillow 25.4/130: 20% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:01.351 focused_rage Fluffy_Pillow 25.4/130: 20% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:01.351 execute Fluffy_Pillow 25.4/130: 20% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:02.351 hamstring Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:02.767 focused_rage Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:02.771 execute Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:03.351 hamstring Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:04.183 focused_rage Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:04.192 hamstring Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:04.351 mortal_strike Fluffy_Pillow 62.2/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
6:05.351 hamstring Fluffy_Pillow 99.0/130: 76% rage avatar, corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:05.558 focused_rage Fluffy_Pillow 99.0/130: 76% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:05.718 execute Fluffy_Pillow 99.0/130: 76% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:07.041 colossus_smash Fluffy_Pillow 99.0/130: 76% rage avatar, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:08.364 execute Fluffy_Pillow 124.2/130: 96% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:09.688 execute Fluffy_Pillow 106.6/130: 82% rage avatar, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:11.012 execute Fluffy_Pillow 74.6/130: 57% rage avatar, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
6:12.333 execute Fluffy_Pillow 67.8/130: 52% rage avatar, focused_rage, cleansed_sisters_blessing, potion_of_the_old_war
6:13.656 heroic_leap Fluffy_Pillow 35.8/130: 28% rage avatar, focused_rage, cleansed_sisters_blessing, potion_of_the_old_war
6:13.656 execute Fluffy_Pillow 35.8/130: 28% rage avatar, focused_rage, cleansed_sisters_blessing, potion_of_the_old_war
6:14.978 execute Fluffy_Pillow 29.0/130: 22% rage avatar, focused_rage, cleansed_sisters_blessing, potion_of_the_old_war
6:16.397 colossus_smash Fluffy_Pillow 0.0/130: 0% rage avatar, focused_rage, potion_of_the_old_war
6:17.819 bladestorm Fluffy_Pillow 0.0/130: 0% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:19.929 execute Fluffy_Pillow 25.2/130: 19% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:21.349 execute Fluffy_Pillow 32.8/130: 25% rage focused_rage, potion_of_the_old_war
6:22.770 Waiting 1.900 sec 0.8/130: 1% rage focused_rage, potion_of_the_old_war
6:24.670 execute Fluffy_Pillow 26.0/130: 20% rage focused_rage, potion_of_the_old_war
6:26.091 Waiting 2.000 sec 0.0/130: 0% rage focused_rage, potion_of_the_old_war
6:28.091 execute Fluffy_Pillow 25.2/130: 19% rage focused_rage
6:29.511 Waiting 2.000 sec 0.0/130: 0% rage focused_rage
6:31.511 execute Fluffy_Pillow 25.2/130: 19% rage focused_rage
6:32.931 colossus_smash Fluffy_Pillow 0.0/130: 0% rage focused_rage
6:34.353 battle_cry Fluffy_Pillow 0.0/130: 0% rage focused_rage, precise_strikes, shattered_defenses
6:34.353 hamstring Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
6:34.353 focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
6:34.353 execute Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
6:35.353 hamstring Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing
6:35.706 focused_rage Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:35.711 mortal_strike Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:36.353 hamstring Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:37.024 focused_rage Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:37.034 execute Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:37.353 hamstring Fluffy_Pillow 37.0/130: 28% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:38.353 hamstring Fluffy_Pillow 74.6/130: 57% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:38.356 focused_rage Fluffy_Pillow 74.6/130: 57% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:38.356 execute Fluffy_Pillow 74.6/130: 57% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:39.679 colossus_smash Fluffy_Pillow 74.6/130: 57% rage focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide
6:41.001 execute Fluffy_Pillow 74.6/130: 57% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide
6:42.324 colossus_smash Fluffy_Pillow 82.2/130: 63% rage focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25283 23577 12226 (10095)
Agility 6579 6254 0
Stamina 31029 31029 19227
Intellect 5328 5003 0
Spirit 2 2 0
Health 1861740 1861740 0
Rage 130 130 0
Crit 9.93% 9.93% 1377
Haste 5.89% 5.89% 1913
Damage / Heal Versatility 11.13% 11.13% 4450
Attack Power 25283 23577 0
Mastery 76.34% 74.20% 10185
Armor 4013 4013 4013
Run Speed 7 0 0
Leech 2.39% 2.39% 549

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Demonsteel Breastplate of the Harmonious
ilevel: 845, stats: { 675 Armor, +1857 Sta, +1238 StrInt, +549 Mastery, +732 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Stormwake Handguards
ilevel: 850, stats: { 427 Armor, +973 StrInt, +1459 Sta, +658 Mastery, +322 Crit }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Nature's Call
ilevel: 850, stats: { +310 Mastery, +310 Haste, +310 Crit }
Local Trinket2 Chrono Shard
ilevel: 850, stats: { +1233 StrAgiInt }, gems: { +150 Mastery }
Local Back Dreamwalker's Cloak
ilevel: 835, stats: { 123 Armor, +635 StrAgiInt, +952 Sta, +496 Haste, +198 Mastery }, gems: { +150 Mastery }, enchant: { +200 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 881, weapon: { 8957 - 13437, 3.6 }, stats: { +1731 Str, +2597 Sta, +745 Crit, +715 Mastery }, relics: { +48 ilevels, +40 ilevels, +43 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=blacksmithing=758/mining=784
talents=http://us.battle.net/wow/en/tool/talent-calculator#Za!0221200
artifact=36:0:0:0:0:1136:1:1137:1:1139:1:1141:1:1142:1:1143:3:1145:3:1146:3:1148:3:1149:3:1150:3:1356:1
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/hamstring,if=!ptr&buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
# The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike.
# In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=buff.shattered_defenses.down
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>=100|buff.focused_rage.stack=3
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=dreamwalkers_cloak,id=139074,bonus_id=3432/1808/1497/1674,gems=150mastery,enchant=200str
chest=demonsteel_breastplate,id=123910,bonus_id=689/1715/3408/601/668
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=stormwake_handguards,id=134508,bonus_id=3412/1502/1813
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=natures_call,id=139334,bonus_id=1807/1472
trinket2=chrono_shard,id=137419,bonus_id=1727/1808/1502/3336,gems=150mastery
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=137371/137363/139251/0,relic_id=3414:1517:3336/1727:1492:1813/1807:1472/0

# Gear Summary
# gear_ilvl=849.73
# gear_strength=12226
# gear_stamina=19227
# gear_crit_rating=1377
# gear_haste_rating=1913
# gear_mastery_rating=10185
# gear_versatility_rating=4450
# gear_leech_rating=549
# gear_armor=4013

Simulation & Raid Information

Iterations: 13
Threads: 4
Confidence: 95.00%
Fight Length: 333 - 488 ( 396.6 )

Performance:

Total Events Processed: 678277
Max Event Queue: 279
Sim Seconds: 5156
CPU Seconds: 1.7188
Physical Seconds: 9.0140
Speed Up: 3000

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Mortwraith Mortwraith annihilation 201427 13491537 34020 9.88 142008 308716 32.7 65.3 37.8% 0.0% 0.0% 0.0% 8.42sec 13491537 396.58sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Mortwraith Mortwraith auto_attack_mh 0 3477385 8768 23.01 19926 39978 152.1 152.1 35.6% 21.3% 0.0% 0.0% 2.54sec 5112085 396.58sec
Mortwraith Mortwraith auto_attack_oh 1 1821976 4594 23.01 9977 19987 152.1 152.1 37.0% 17.2% 0.0% 0.0% 2.54sec 2678477 396.58sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 69.09sec 0 396.58sec
Mortwraith Mortwraith chaos_blade_mh 211796 4020440 10138 3.18 137355 275910 21.0 21.0 39.2% 0.0% 0.0% 0.0% 16.55sec 4020440 396.58sec
Mortwraith Mortwraith chaos_blade_oh 211797 1954454 4928 3.18 68517 138400 21.0 21.0 34.9% 0.0% 0.0% 0.0% 16.55sec 1954454 396.58sec
Mortwraith Mortwraith chaos_blades 211048 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 123.85sec 0 396.58sec
Mortwraith Mortwraith chaos_strike 162794 27385139 69054 29.27 98463 215210 96.8 193.4 37.3% 0.0% 0.0% 0.0% 3.71sec 27385139 396.58sec
Mortwraith Mortwraith demon_blades 203796 7175862 18094 32.56 23833 47975 215.2 215.2 39.2% 0.0% 0.0% 0.0% 4.74sec 7175862 396.58sec
Mortwraith Mortwraith eye_beam ticks -198013 3899650 9749 11.68 0 49671 8.1 77.9 100.0% 0.0% 0.0% 0.0% 47.97sec 3899650 396.58sec
Mortwraith Mortwraith anguish 202446 1586492 4000 1.23 147638 304041 0.0 8.1 32.9% 0.0% 0.0% 0.0% 0.00sec 1586492 396.58sec
Mortwraith Mortwraith fel_rush 195072 8857936 22336 7.40 134806 268079 48.9 48.9 35.2% 0.0% 0.0% 0.0% 8.09sec 8857936 396.58sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 4175332 10438 7.57 31129 61641 7.2 50.4 35.6% 0.0% 0.0% 0.0% 60.28sec 4175332 396.58sec
Mortwraith Mortwraith rage_of_the_illidari 217070 2468526 6225 1.08 353063 0 7.1 7.1 0.0% 0.0% 0.0% 0.0% 60.30sec 2468526 396.58sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Mortwraith Mortwraith metamorphosis_impact 200166 167936 423 0.30 59553 118285 2.0 2.0 38.9% 0.0% 0.0% 0.0% 0.00sec 167936 396.58sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Mortwraith Mortwraith potion_of_the_old_war 188028 5582547 14077 3.88 160847 323995 25.7 25.7 34.6% 0.0% 0.0% 0.0% 11.14sec 8206874 396.58sec
Mortwraith Mortwraith throw_glaive 185123 7995546 20161 7.43 117088 231979 49.1 49.1 39.6% 0.0% 0.0% 0.0% 8.12sec 11754209 396.58sec
Mortwraith Mortwraith bloodlet ticks -207690 11798608 29497 28.63 61847 0 0.0 190.9 0.0% 0.0% 0.0% 0.0% 0.00sec 11798608 396.58sec
Mortwraith Mortwraith vengeful_retreat 198793 399422 1007 2.42 17258 34448 16.0 16.0 44.4% 0.0% 0.0% 0.0% 25.46sec 587188 396.58sec
Táunks Táunks annihilation 201427 10012762 25248 8.57 118120 268616 28.3 56.7 38.8% 0.0% 0.0% 0.0% 9.43sec 10012762 396.58sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Táunks Táunks auto_attack_mh 0 3667543 9248 25.90 18688 37337 171.2 171.2 35.4% 20.6% 0.0% 0.0% 2.30sec 5391636 396.58sec
Táunks Táunks auto_attack_oh 1 1855451 4679 25.90 9365 18680 171.2 171.2 35.5% 19.7% 0.0% 0.0% 2.30sec 2727689 396.58sec
Táunks Táunks chaos_strike 162794 23400751 59007 26.86 90760 202280 88.9 177.6 36.8% 0.0% 0.0% 0.0% 4.24sec 23400751 396.58sec
Táunks Táunks demon_blades 203796 7031359 17730 30.61 25249 50979 202.3 202.3 36.8% 0.0% 0.0% 0.0% 4.37sec 7031359 396.58sec
Táunks Táunks eye_beam ticks -198013 3560414 8901 12.00 0 44565 8.0 80.0 100.0% 0.0% 0.0% 0.0% 49.01sec 3560414 396.58sec
Táunks Táunks anguish 202446 1499640 3781 1.21 136081 280307 0.0 8.0 34.7% 0.0% 0.0% 0.0% 0.00sec 1499640 396.58sec
Táunks Táunks fel_barrage 211053 4947762 12476 6.47 82993 164529 8.6 42.8 39.0% 0.0% 0.0% 0.0% 51.15sec 4947762 396.58sec
Táunks Táunks fel_rush 195072 6647614 16762 6.15 121167 243058 40.7 40.7 34.7% 0.0% 0.0% 0.0% 9.81sec 6647614 396.58sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Táunks Táunks fury_of_the_illidari ticks -201467 3587288 8968 7.43 26975 53094 7.2 49.6 35.4% 0.0% 0.0% 0.0% 60.27sec 3587288 396.58sec
Táunks Táunks inner_demons 202388 2354926 5938 1.13 232987 450943 7.4 7.4 37.3% 0.0% 0.0% 0.0% 53.37sec 2354926 396.58sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Táunks Táunks metamorphosis_impact 200166 136214 343 0.30 55888 104431 2.0 2.0 22.2% 0.0% 0.0% 0.0% 0.00sec 136214 396.58sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Táunks Táunks potion_of_the_old_war 188028 4902211 12361 4.02 135733 268763 26.6 26.6 36.8% 0.0% 0.0% 0.0% 10.40sec 7206715 396.58sec
Táunks Táunks throw_glaive 185123 7242022 18261 7.55 106849 213460 49.9 49.9 36.1% 0.0% 0.0% 0.0% 7.93sec 10646458 396.58sec
Táunks Táunks bloodlet ticks -207690 10655837 26640 27.75 58126 0 0.0 185.0 0.0% 0.0% 0.0% 0.0% 0.00sec 10655837 396.58sec
Táunks Táunks vengeful_retreat 198793 358755 905 2.45 15827 31655 16.2 16.2 39.7% 0.0% 0.0% 0.0% 25.24sec 527403 396.58sec
Buuey Buuey augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey blessing_of_elune 202737 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey celestial_alignment 194223 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 183.39sec 0 396.58sec
Buuey Buuey deadly_grace 188091 3199514 8068 3.78 105050 214488 25.0 25.0 20.4% 0.0% 0.0% 0.0% 10.14sec 3199514 396.58sec
Buuey Buuey flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey full_moon 202771 7181876 18110 1.28 674988 1376976 9.2 8.4 25.0% 0.0% 0.0% 0.0% 44.67sec 7181876 396.58sec
Buuey Buuey half_moon 202768 4004938 10099 1.45 337495 688489 9.6 9.6 23.3% 0.0% 0.0% 0.0% 43.04sec 4004938 396.58sec
Buuey Buuey lunar_strike 194153 14463624 36471 8.44 195609 400107 55.8 55.8 31.3% 0.0% 0.0% 0.0% 7.12sec 14463624 396.58sec
Buuey Buuey moonfire 8921 1242964 3134 2.81 56193 111654 18.6 18.6 18.0% 0.0% 0.0% 0.0% 21.98sec 9412160 396.58sec
Buuey Buuey moonfire ticks -8921 8169196 20423 35.88 28038 57033 18.6 239.2 21.0% 0.0% 0.0% 0.0% 21.98sec 9412160 396.58sec
Buuey Buuey moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey new_moon 202767 2116474 5337 1.51 168748 344246 9.0 10.0 24.4% 0.0% 0.0% 0.0% 45.26sec 2116474 396.58sec
Buuey Buuey potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Buuey Buuey solar_wrath 190984 13234924 33373 11.77 140782 281729 78.0 77.8 20.7% 0.0% 0.0% 0.0% 4.96sec 13234924 396.58sec
Buuey Buuey starfall ticks -191034 3709814 9275 0.00 25166 51193 11.7 0.0 21.8% 0.0% 0.0% 0.0% 27.97sec 3709814 396.58sec
Buuey Buuey starsurge 78674 20803575 52458 8.56 259667 532461 56.7 56.6 39.9% 0.0% 0.0% 0.0% 6.98sec 20803575 396.58sec
Buuey Buuey goldrinns_fang 203001 3537533 8920 2.72 156050 329333 18.1 18.0 24.1% 0.0% 0.0% 0.0% 25.76sec 3537533 396.58sec
Buuey Buuey stellar_flare 202347 2074322 5231 2.59 95429 175110 17.1 17.1 31.2% 0.0% 0.0% 0.0% 23.91sec 10871954 396.58sec
Buuey Buuey stellar_flare ticks -202347 8797632 21994 35.58 30223 61284 17.1 237.2 21.8% 0.0% 0.0% 0.0% 23.91sec 10871954 396.58sec
Buuey Buuey sunfire 93402 945427 2384 2.12 55079 111244 14.0 14.0 25.4% 0.0% 0.0% 0.0% 29.66sec 8942392 396.58sec
Buuey Buuey sunfire ticks -93402 7996965 19992 35.87 27275 55641 14.0 239.1 21.8% 0.0% 0.0% 0.0% 29.66sec 8942392 396.58sec
Buuey Buuey tormenting_cyclone 221857 1457903 3676 15.03 12239 24998 14.3 99.3 19.5% 0.0% 0.0% 0.0% 27.52sec 1457903 396.58sec
Oinkie Oinkie ashamanes_frenzy 210722 1117511 2818 12.86 9889 20126 5.7 85.0 31.8% 0.0% 0.0% 0.0% 79.25sec 6517819 396.58sec
Oinkie Oinkie ashamanes_frenzy ticks -210722 4938797 12347 17.00 124989 259166 5.7 113.3 36.9% 0.0% 0.0% 0.0% 79.25sec 6517819 396.58sec
Oinkie Oinkie ashamanes_rip ticks -210705 13252434 33131 21.92 67736 136705 17.2 146.1 33.0% 0.0% 0.0% 0.0% 20.57sec 13252434 396.58sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Oinkie Oinkie cat_melee 0 11263090 28401 72.20 17434 35501 477.2 477.2 34.2% 0.0% 0.0% 0.0% 0.83sec 15833369 396.58sec
Oinkie Oinkie ferocious_bite 22568 8650079 21812 4.27 217403 494752 28.2 28.2 31.9% 0.0% 0.0% 0.0% 13.16sec 12159059 396.58sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Oinkie Oinkie healing_touch 5185 0 0 0.00 0 0 51.2 0.0 0.0% 0.0% 0.0% 0.0% 7.67sec 0 396.58sec
Oinkie Oinkie incarnation 102543 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 181.06sec 0 396.58sec
Oinkie Oinkie lunar_inspiration 155625 1173069 2958 4.20 31151 63840 27.8 27.8 34.0% 0.0% 0.0% 0.0% 14.31sec 8775242 396.58sec
Oinkie Oinkie lunar_inspiration ticks -155625 7602173 19005 35.45 24028 49129 27.8 236.3 32.5% 0.0% 0.0% 0.0% 14.31sec 8775242 396.58sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Oinkie Oinkie potion_of_the_old_war 188028 4377597 11038 3.85 129832 268023 25.4 25.4 31.0% 0.0% 0.0% 0.0% 13.30sec 6435483 396.58sec
Oinkie Oinkie rake 1822 4976914 12550 6.10 94714 197441 40.3 40.3 29.2% 0.0% 0.0% 0.0% 9.83sec 28867011 396.58sec
Oinkie Oinkie rake ticks -1822 23890097 59725 29.27 93110 185971 40.3 195.1 32.6% 0.0% 0.0% 0.0% 9.83sec 28867011 396.58sec
Oinkie Oinkie rip ticks -1079 27681333 69203 44.05 70149 143238 22.3 293.7 33.1% 0.0% 0.0% 0.0% 14.34sec 27681333 396.58sec
Oinkie Oinkie shred 5221 16214318 40886 15.55 78017 200987 102.8 102.8 65.5% 0.0% 0.0% 0.0% 3.88sec 22744823 396.58sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 30.70sec 0 396.58sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 85.03sec 0 396.58sec
Rothlandra Rothlandra aimed_shot 19434 40412166 101902 15.40 261402 597154 101.8 101.8 40.0% 0.0% 0.0% 0.0% 3.95sec 59409712 396.58sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 90.67sec 0 396.58sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Rothlandra Rothlandra auto_shot 0 4808570 12125 22.00 24164 52045 145.4 145.4 31.7% 0.0% 0.0% 0.0% 2.71sec 7069054 396.58sec
Rothlandra Rothlandra barrage ticks -120360 13382318 33456 43.13 34921 73557 18.0 287.6 31.1% 0.0% 0.0% 0.0% 22.50sec 19673275 396.58sec
Rothlandra Rothlandra deadly_grace 188091 4076254 10279 4.67 81344 207586 30.9 30.9 39.6% 0.0% 0.0% 0.0% 13.39sec 4076254 396.58sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Rothlandra Rothlandra marked_shot 185901 14777017 37261 5.35 301236 664153 35.3 35.3 32.7% 0.0% 0.0% 0.0% 10.81sec 21723614 396.58sec
Rothlandra Rothlandra pepper_breath ticks -225622 1437973 3595 12.70 16986 0 17.1 84.7 0.0% 0.0% 0.0% 0.0% 24.82sec 1437973 396.58sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Rothlandra Rothlandra sidewinders 214579 5486694 13835 6.07 98171 215862 40.1 40.1 33.0% 0.0% 0.0% 0.0% 9.85sec 5486694 396.58sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 178.20sec 0 396.58sec
Rothlandra Rothlandra windburst 204147 8536126 21524 2.81 349205 759142 17.6 18.6 26.3% 0.0% 0.0% 0.0% 22.23sec 12548914 396.58sec
Sarkul Sarkul aimed_shot 19434 49458184 124712 17.89 294113 671710 118.3 118.2 33.2% 0.0% 0.0% 0.0% 3.37sec 72708215 396.58sec
Sarkul Sarkul legacy_of_the_windrunners 19434 9436336 23794 18.26 54321 125017 0.0 120.7 33.3% 0.0% 0.0% 0.0% 0.00sec 13872308 396.58sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Sarkul Sarkul auto_shot 0 5214239 13148 23.90 25099 54331 158.0 158.0 27.1% 0.0% 0.0% 0.0% 2.51sec 7665426 396.58sec
Sarkul Sarkul volley 194386 8954083 22578 23.90 42707 93507 159.0 158.0 27.8% 0.0% 0.0% 0.0% 2.51sec 13163350 396.58sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 396.58sec
Sarkul Sarkul deadly_grace 188091 4160893 10492 5.04 80707 205776 33.3 33.3 35.3% 0.0% 0.0% 0.0% 11.79sec 4160893 396.58sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1457706 3676 3.21 50459 107072 21.2 21.2 31.9% 0.0% 0.0% 0.0% 18.47sec 1457706 396.58sec
Sarkul Sarkul marked_shot 185901 17362719 43781 5.35 327910 729852 35.3 35.3 40.9% 0.0% 0.0% 0.0% 11.43sec 25524842 396.58sec
Sarkul Sarkul pepper_breath ticks -225622 1568743 3922 13.95 16977 0 19.0 93.0 0.0% 0.0% 0.0% 0.0% 22.47sec 1568743 396.58sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Sarkul Sarkul rancid_maw 215405 4485636 11311 2.61 193161 412663 17.6 17.2 30.3% 0.0% 0.0% 0.0% 22.00sec 4485636 396.58sec
Sarkul Sarkul sidewinders 214579 5416404 13658 6.20 100931 220047 41.0 41.0 26.3% 0.0% 0.0% 0.0% 9.71sec 5416404 396.58sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 396.58sec
Sarkul Sarkul windburst 204147 9350296 23577 2.81 391641 813426 17.6 18.6 26.3% 0.0% 0.0% 0.0% 22.22sec 13745820 396.58sec
Zipi Zipi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Zipi Zipi blade_of_wrath 202270 7068415 17824 10.14 83324 171137 67.0 67.0 25.5% 0.0% 0.0% 0.0% 5.79sec 12502825 396.58sec
Zipi Zipi blade_of_wrath ticks -202270 5434409 13586 27.23 24017 48594 67.0 181.6 24.7% 0.0% 0.0% 0.0% 5.79sec 12502825 396.58sec
Zipi Zipi blessing_of_might_proc 205729 8506201 21449 22.95 55459 0 185.6 151.7 0.0% 0.0% 0.0% 0.0% 2.41sec 8506201 396.58sec
Zipi Zipi crusade 224668 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.17sec 0 396.58sec
Zipi Zipi crusader_strike 35395 13642560 34401 16.71 87081 176216 110.4 110.4 41.6% 0.0% 0.0% 0.0% 3.56sec 20055855 396.58sec
Zipi Zipi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Zipi Zipi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Zipi Zipi greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Zipi Zipi judgment 20271 9806660 24728 6.37 180449 373327 42.1 42.1 27.7% 0.0% 0.0% 0.0% 9.34sec 9806660 396.58sec
Zipi Zipi judgment_aoe 228288 0 0 0.00 0 0 42.1 0.0 0.0% 0.0% 0.0% 0.0% 9.34sec 0 396.58sec
Zipi Zipi melee 0 5894722 14864 21.40 33847 68711 141.4 141.4 22.9% 0.0% 0.0% 0.0% 2.78sec 8665800 396.58sec
Zipi Zipi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Zipi Zipi potion_of_the_old_war 188028 6583138 16600 4.62 168104 339229 30.6 30.6 27.6% 0.0% 0.0% 0.0% 5.42sec 9677836 396.58sec
Zipi Zipi shield_of_vengeance 184662 0 0 0.57 0 0 3.8 3.8 23.5% 0.0% 0.0% 0.0% 120.00sec 2650137 396.58sec
Zipi Zipi shield_of_vengeance_proc 184689 5172166 13042 0.54 1119318 2114960 3.8 3.6 34.4% 0.0% 0.0% 0.0% 118.87sec 5172166 396.58sec
Zipi Zipi templars_verdict 85256 42812263 107954 15.95 327082 669399 105.4 105.4 23.6% 0.0% 0.0% 0.0% 3.73sec 42812263 396.58sec
Zipi Zipi wake_of_ashes 205273 3177441 8012 1.88 205376 414312 12.4 12.4 25.0% 0.0% 0.0% 0.0% 34.03sec 6403037 396.58sec
Zipi Zipi wake_of_ashes ticks -205273 3225595 8064 11.08 34513 70963 12.4 73.9 25.9% 0.0% 0.0% 0.0% 34.03sec 6403037 396.58sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 186.62sec 0 396.58sec
Raji Raji deadly_grace 188091 3345484 8436 4.40 90609 176486 29.1 29.1 28.2% 0.0% 0.0% 0.0% 13.37sec 3345484 396.58sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Raji Raji mind_blast 8092 7670348 19341 7.62 116387 232070 49.3 50.3 31.1% 0.0% 0.0% 0.0% 8.02sec 7670348 396.58sec
Raji Raji mind_flay ticks -15407 11818534 29546 51.03 27157 54604 109.9 340.2 27.5% 0.0% 0.0% 0.0% 3.59sec 11818534 396.58sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 60.38sec 0 396.58sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Raji Raji shadow_word_death 32379 2970497 7490 2.08 167202 336463 13.8 13.8 29.0% 0.0% 0.0% 0.0% 9.97sec 2970497 396.58sec
Raji Raji shadow_word_pain 589 911272 2298 3.50 29901 58800 23.1 23.1 32.2% 0.0% 0.0% 0.0% 14.54sec 12658656 396.58sec
Raji Raji shadow_word_pain ticks -589 11747384 29368 42.88 32216 64322 23.1 285.9 27.6% 0.0% 0.0% 0.0% 14.54sec 12658656 396.58sec
Raji Raji shadowy_apparitions 78203 3374833 8510 17.01 23380 46734 113.8 112.4 28.1% 0.0% 0.0% 0.0% 3.27sec 3374833 396.58sec
Raji Raji vampiric_touch ticks -34914 15066010 37665 28.42 61018 121178 1.0 189.4 30.8% 0.0% 0.0% 0.0% 0.00sec 15066010 396.58sec
Raji Raji void_bolt 205448 15880577 40044 11.25 163188 327474 74.4 74.3 30.8% 0.0% 0.0% 0.0% 5.06sec 15880577 396.58sec
Raji Raji void_eruption 228360 1492694 3764 3.33 51114 102870 11.0 22.0 32.3% 0.0% 0.0% 0.0% 36.56sec 1492694 396.58sec
Raji Raji void_torrent ticks -205065 5436329 13591 6.95 91975 187076 6.7 46.3 26.9% 0.0% 0.0% 0.0% 63.66sec 5436329 396.58sec
Raji Raji volatile_ichor 222187 2468889 6225 3.29 95931 193480 21.8 21.8 17.3% 0.0% 0.0% 0.0% 15.89sec 2468889 396.58sec
Raji Raji_mindbender melee 0 6509207 63253 53.90 53411 106994 92.4 92.4 31.7% 0.0% 0.0% 0.0% 4.21sec 6509207 102.91sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 20.9 0.0 0.0% 0.0% 0.0% 0.0% 19.13sec 0 102.91sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 3667378 9168 13.20 31585 63170 9.8 88.0 31.9% 0.0% 0.0% 0.0% 39.32sec 3667378 97.76sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 765938 1915 2.87 31585 63170 2.1 19.1 26.8% 0.0% 0.0% 0.0% 61.62sec 765938 21.25sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 379021 948 1.35 31585 63170 1.0 9.0 33.3% 0.0% 0.0% 0.0% 0.00sec 379021 10.00sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 64.07sec 0 396.58sec
Vait Vait ambush 8676 1064460 2684 1.06 111927 222481 7.0 7.0 36.5% 0.0% 0.0% 0.0% 52.82sec 1564857 396.58sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Vait Vait auto_attack_mh 0 8182842 20634 38.33 27060 54103 253.3 253.3 37.3% 18.0% 0.0% 0.0% 1.51sec 12029553 396.58sec
Vait Vait auto_attack_oh 1 4019531 10136 37.47 13536 27064 247.7 247.7 38.9% 19.0% 0.0% 0.0% 1.55sec 5909092 396.58sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 91.69sec 0 396.58sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Vait Vait ghostly_strike 196937 1584512 3995 4.12 43824 87954 27.2 27.2 32.2% 0.0% 0.0% 0.0% 14.84sec 2329382 396.58sec
Vait Vait gouge 1776 0 0 0.00 0 0 20.8 0.0 0.0% 0.0% 0.0% 0.0% 16.82sec 0 396.58sec
Vait Vait greed 202822 4709768 11876 5.97 88848 177701 39.4 39.4 34.4% 0.0% 0.0% 0.0% 11.64sec 6923805 396.58sec
Vait Vait greed_oh 202823 2452761 6185 5.97 44435 88818 39.4 39.4 40.0% 0.0% 0.0% 0.0% 11.64sec 3605791 396.58sec
Vait Vait main_gauche 86392 9702272 24465 36.36 29298 58590 240.3 240.3 37.8% 0.0% 0.0% 0.0% 1.59sec 14263258 396.58sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 15.4 0.0 0.0% 0.0% 0.0% 0.0% 22.80sec 0 396.58sec
Vait Vait pistol_shot 185763 3186662 8035 6.64 44962 89859 43.9 43.9 61.5% 0.0% 0.0% 0.0% 8.53sec 4684695 396.58sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Vait Vait potion_of_the_old_war 188028 4856955 12247 3.95 132625 264507 26.1 26.1 40.4% 0.0% 0.0% 0.0% 5.49sec 7140184 396.58sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 28.62sec 0 396.58sec
Vait Vait run_through 2098 49751702 125452 15.82 347469 690406 104.6 104.6 37.4% 0.0% 0.0% 0.0% 3.80sec 73139714 396.58sec
Vait Vait saber_slash 193315 24840763 62638 33.76 80225 160503 223.1 223.1 38.7% 0.0% 0.0% 0.0% 1.78sec 36518275 396.58sec
Vait Vait sprint 2983 0 0 0.00 0 0 15.7 0.0 0.0% 0.0% 0.0% 0.0% 23.12sec 0 396.58sec
Vait Vait touch_of_the_grave 127802 1064197 2683 3.66 43905 0 24.2 24.2 0.0% 0.0% 0.0% 0.0% 16.78sec 1064197 396.58sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 52.72sec 0 396.58sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.00sec 0 396.58sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Alacastria Alacastria auto_attack_mh 0 8656816 21829 18.46 56850 115447 122.0 122.0 24.6% 0.0% 0.0% 0.0% 3.31sec 12726339 396.58sec
Alacastria Alacastria avatar 107574 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 90.00sec 0 396.58sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 32.55sec 0 396.58sec
Alacastria Alacastria bladestorm 227847 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 119.55sec 0 396.58sec
Alacastria Alacastria bladestorm_mh 50622 797257 2010 1.31 88186 150238 0.0 8.7 9.0% 0.0% 0.0% 0.0% 0.00sec 1172043 396.58sec
Alacastria Alacastria charge 100 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 85.15sec 0 396.58sec
Alacastria Alacastria cleansed_drakes_breath 222520 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 111.39sec 0 396.58sec
Alacastria Alacastria colossus_smash 167105 16419475 41403 8.56 237015 455071 56.6 56.6 25.3% 0.0% 0.0% 0.0% 7.38sec 24138183 396.58sec
Alacastria Alacastria corrupted_blood_of_zakajz ticks -209569 11700159 29250 11.12 160434 0 0.0 74.1 0.0% 0.0% 0.0% 0.0% 0.00sec 11700159 396.58sec
Alacastria Alacastria execute 163201 16641908 41964 4.86 362609 819246 32.1 32.1 34.9% 0.0% 0.0% 0.0% 2.38sec 24465181 396.58sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Alacastria Alacastria focused_rage 207982 0 0 0.00 0 0 124.1 0.0 0.0% 0.0% 0.0% 0.0% 3.24sec 0 396.58sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Alacastria Alacastria hamstring 1715 327471 826 9.41 0 5310 62.2 62.2 100.0% 0.0% 0.0% 0.0% 6.40sec 481414 396.58sec
Alacastria Alacastria heroic_leap 6544 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 32.07sec 0 396.58sec
Alacastria Alacastria mortal_strike 12294 43135001 108768 11.03 361565 842106 72.9 72.9 48.8% 0.0% 0.0% 0.0% 5.57sec 63412537 396.58sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 396.58sec
Alacastria Alacastria potion_of_the_old_war 188028 9584942 24169 3.66 289515 588924 24.2 24.2 33.0% 0.0% 0.0% 0.0% 18.59sec 14090772 396.58sec
Alacastria Alacastria slam 1464 18759923 47304 16.58 136088 270133 109.6 109.6 26.4% 0.0% 0.0% 0.0% 2.87sec 27578864 396.58sec
Alacastria Alacastria warbreaker 209577 1915054 4829 0.96 239387 492582 6.3 6.3 24.6% 0.0% 0.0% 0.0% 67.97sec 1915054 396.58sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.72% 9.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.95% 8.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.56% 10.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.32% 11.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.13% 11.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.84% 10.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.72% 11.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.83% 11.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.17% 9.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.75% 4.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 8.0 72.0 48.2sec 4.4sec 7.10% 7.10% 0.0(0.0) 8.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.34%
  • anguish_2:0.34%
  • anguish_3:0.34%
  • anguish_4:0.34%
  • anguish_5:0.34%
  • anguish_6:0.34%
  • anguish_7:0.34%
  • anguish_8:0.34%
  • anguish_9:0.34%
  • anguish_10:4.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 8.1 69.8 46.9sec 4.4sec 7.12% 7.12% 0.0(0.0) 8.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.35%
  • anguish_2:0.41%
  • anguish_3:0.39%
  • anguish_4:0.45%
  • anguish_5:0.33%
  • anguish_6:0.33%
  • anguish_7:0.33%
  • anguish_8:0.38%
  • anguish_9:0.33%
  • anguish_10:3.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
colossus_smash 15.8 47.1 25.9sec 6.4sec 81.38% 80.46% 47.1(47.1) 15.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:81.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Ghostly Strike 4.9 22.3 66.1sec 14.8sec 98.17% 98.53% 101.2(101.2) 3.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:98.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 35.4 0.1 11.3sec 11.3sec 48.05% 49.93% 0.1(0.1) 0.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:48.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 35.4 0.0 11.0sec 11.0sec 49.34% 49.92% 0.0(0.0) 0.1

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:49.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 34.1 50.1 11.6sec 4.7sec 82.30% 75.57% 50.1(50.1) 33.4

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:82.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to $s3 other nearby enemies]?s137027[ and $s2 other nearby enemy][], dealing $s1 Holy damage{$?s76672=false}[, and causing them to take $197277s2% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s137029[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?s137028[, and reducing the remaining cooldown on Shield of the Righteous by $s2 sec, or ${$m2*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 3.2 12.2 98.6sec 25.7sec 99.30% 99.30% 12.2(12.2) 2.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:99.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Open Wounds 3.0 19.3 86.1sec 14.1sec 90.90% 88.49% 19.3(19.3) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:90.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Stellar Empowerment 10.2 1.4 36.4sec 30.7sec 22.72% 22.61% 1.4(1.4) 10.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:22.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 14.9 80.0 25.2sec 4.2sec 95.41% 91.26% 80.0(80.0) 14.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:95.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2%.$?a190529[ Aimed Shot critical strike chance increased by $s3%.][] Lasts $6d. Stacks up to {$u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 13.6 80.4 29.2sec 4.2sec 93.76% 90.07% 80.4(80.4) 12.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:93.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2%.$?a190529[ Aimed Shot critical strike chance increased by $s3%.][] Lasts $6d. Stacks up to {$u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:78.72%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 2732483.13
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 10
death count pct 76.92
avg death time 393.40
min death time 333.17
max death time 487.55
dmg taken 1083736175.38

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9
Mean 396.58
Minimum 333.17
Maximum 487.55
Spread ( max - min ) 154.37
Range [ ( max - min ) / 2 * 100% ] 19.46%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9
Mean 2736025.83
Minimum 2679265.63
Maximum 2782387.32
Spread ( max - min ) 103121.68
Range [ ( max - min ) / 2 * 100% ] 1.88%
Standard Deviation 34228.6253
5th Percentile 2679265.63
95th Percentile 2775122.44
( 95th Percentile - 5th Percentile ) 95856.81
Mean Distribution
Standard Deviation 11409.5418
95.00% Confidence Intervall ( 2713663.54 - 2758388.12 )
Normalized 95.00% Confidence Intervall ( 99.18% - 100.82% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 6
0.1% Error 601
0.1 Scale Factor Error with Delta=300 10001441
0.05 Scale Factor Error with Delta=300 40005764
0.01 Scale Factor Error with Delta=300 1000144116
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 872706646 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.